DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34039 and Commd4

DIOPT Version :8

Sequence 1:NP_001034012.2 Gene:CG34039 / 3885643 FlyBaseID:FBgn0054039 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_079693.1 Gene:Commd4 / 66199 MGIID:1913449 Length:199 Species:Mus musculus

Alignment Length:208 Identity:68/209 (33%)
Similarity:108/209 (52%) Gaps:32/209 (15%)


  Fly     1 MKFRFCGEGDCPDWVLAEIISTLSNLSIENLEQLSDLVAQRICGETFEEAKIKSLTSTLTNEG-- 63
            |:|||||:.||||||||| ||||:.:|...|..|...|.:.:.|:..:..||..||:....|.  
Mouse     1 MRFRFCGDLDCPDWVLAE-ISTLAKISSVKLRLLCSQVLKELLGQGIDYEKILKLTADAKFESGD 64

  Fly    64 -KTAVACINFMLTSAARYSCSESIFGEEIQQLGLPKDHAAAMCRVLQKHSATIRQTLINKSFRIN 127
             |..||.::|:|:|||::|........|:|||||||:||.::||..::..:.:::.|...|.|:|
Mouse    65 VKATVAVLSFILSSAAKHSVDSDSLSSELQQLGLPKEHATSLCRCYEEKQSPLQEHLRACSLRVN 129

  Fly   128 ELTSVRDISTPGQTPPNYATLELKISQELVDGLPKDTTHV----------------LNIDRTQMK 176
            .|.||.            ..::..:|..|:..:.:...|:                :::...:.:
Mouse   130 RLASVG------------WRVDYTLSSSLLHSVEEPMVHLQLQVVPAPGTQAQPVSMSLSADKFQ 182

  Fly   177 ALLAELKLARDVM 189
            .||||||.|:.:|
Mouse   183 VLLAELKQAQTMM 195

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34039NP_001034012.2 HCaRG 23..190 CDD:284632 50/187 (27%)
Commd4NP_079693.1 Commd4 25..198 CDD:240100 49/184 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C140937950
eggNOG 1 0.900 E1_28K8D
Hieranoid 1 1.000
Homologene 1 1.000 H9865
Inparanoid 1 1.050 107 1.000 Inparanoid score I4873
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005079
OrthoInspector 1 1.000 T1082371
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR16231
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3436
TreeFam 1 0.960
1211.890

Return to query results.
Submit another query.