DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34039 and COMMD7

DIOPT Version :8

Sequence 1:NP_001034012.2 Gene:CG34039 / 3885643 FlyBaseID:FBgn0054039 Length:198 Species:Drosophila melanogaster
Sequence 2:XP_005260356.1 Gene:COMMD7 / 149951 HGNCID:16223 Length:242 Species:Homo sapiens

Alignment Length:141 Identity:26/142 (18%)
Similarity:56/142 (39%) Gaps:29/142 (20%)


  Fly     6 CGEGDCPDWVLAEIISTLSNLSIENLEQLSDLVAQRICGET-------FEEAKIKSLTSTLTNEG 63
            |.|...|:.|..:            ::||:.|.||:....|       .|..:::...:.|:...
Human     6 CTEDPVPEAVGGD------------MQQLNQLGAQQFSALTEVLFHFLTEPKEVERFLAQLSEFA 58

  Fly    64 KT------AVACINFMLTSAARYSCSESIFGEEIQ----QLGLPKDHAAAMCRVLQKHSATIRQT 118
            .|      ::..|...|......:..:|:..:::|    .|||.::.|.......::::.|:.:.
Human    59 TTNQISLGSLRSIVKSLLLVPNGALKKSLTAKQVQADFITLGLSEEKATYFSEKWKQNAPTLARW 123

  Fly   119 LINKSFRINEL 129
            .|.::..||:|
Human   124 AIGQTLMINQL 134

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34039NP_001034012.2 HCaRG 23..190 CDD:284632 22/125 (18%)
COMMD7XP_005260356.1 Commd7 19..175 CDD:240103 22/117 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.