DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33993 and Tns1

DIOPT Version :8

Sequence 1:NP_001033991.1 Gene:CG33993 / 3885637 FlyBaseID:FBgn0053993 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001178739.1 Gene:Tns1 / 301509 RGDID:68427 Length:1909 Species:Rattus norvegicus

Alignment Length:494 Identity:122/495 (25%)
Similarity:167/495 (34%) Gaps:122/495 (25%)


  Fly    12 PQHSKATFISSSSASSSSSQTAETTLIETAEKSP-ASEAAAGTVTTTSPQHFFHHHHP----PAH 71
            |.:|...|  |||..|..........:.....|| |.....||.|..||.......:|    |..
  Rat  1320 PDYSLQPF--SSSPESQGQPHFSAASVHMVPGSPQARHRTVGTNTPPSPGFGRRAINPTMAAPGS 1382

  Fly    72 PHPPRQQ---------------PHPHSHSHPHPHPQLQRRPVEQLHLLHSHHDVQELSGQEHPHP 121
            |....:|               .||.|.:.....|.|.|.||....:...|..|....|.    |
  Rat  1383 PSLSHRQVMGPSGPGFHGNVVSGHPTSATVAPGSPSLGRHPVGSHQVPGLHSGVVTTPGS----P 1443

  Fly   122 QPGSHPHPHHLRSPSSEEDN------SPT---EMNNCRRLVDKPPLVKRLTMGIGLLRGTEDSRP 177
            ..|.||..|.....||...|      ||:   .:.....:|...|.:.| .:..|.....||.||
  Rat  1444 SLGRHPGAHQGNLVSSLHGNAVISPGSPSLGRHLGGSGSVVPGSPSLDR-HVAYGGYSTPEDRRP 1507

  Fly   178 LMHSTCGSSLTSGSGCGSTQTISDGYVNEAICEPDKYVASKF--GDSCRQSLSALESATQRLQVE 240
            .:               |.|:.:.||  :|...|...|:..:  |.|...:..:.:||..|....
  Rat  1508 TL---------------SRQSSASGY--QAPSTPSFPVSPAYYPGLSSPATSPSPDSAAFRQGSP 1555

  Fly   241 LPAASKK--------------YLRETCSANSSP-----------------KLFPGHSALRLDNLS 274
            .||..:|              |.......:|||                 ...|..|...:.:.|
  Rat  1556 TPALPEKRRMSVGDRAGSLPNYATINGKVSSSPVANGMASPSGSSTVSFSHTLPDFSKYSMPDNS 1620

  Fly   275 LAEQQELK-----GAAWFQAGIPREISLEALSRQSPGAFLVRQSSTKPGCFALSLRVPPPSPR-- 332
            ...:.::|     ...|::..|.||.::..|..|.||||::|.|.:..|.:.|:::|..|.|.  
  Rat  1621 PETRAKVKFVQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTIT 1685

  Fly   333 ------------VAHYLILRTQRGYKIKGFTKE--FSSLKALITHHSVMPELLPVPLTLP-RPPS 382
                        |.|:||....||.|:||...|  |.||.||:..|||:|..||..|.:| |.|:
  Rat  1686 QQGKKGDMTHELVRHFLIETGPRGVKLKGCPNEPNFGSLSALVYQHSVIPLALPCKLVIPSRDPT 1750

  Fly   383 TRSQRSQGAYAGGTGNGGADFEMYGSLNDFRKMMADLNV 421
            ..|:.|.|.              ..|..|..|..|..||
  Rat  1751 DESKDSSGP--------------ANSTTDLLKQGAACNV 1775

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33993NP_001033991.1 SH2 286..364 CDD:198173 32/94 (34%)
Tns1NP_001178739.1 C1 <75..108 CDD:237996
PTPc_motif 250..365 CDD:214649
PTEN_C2 352..478 CDD:287393
SH2_Tensin_like 1633..1748 CDD:198181 41/115 (36%)
PTB_tensin 1770..1903 CDD:269924 3/7 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45734
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.