DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33993 and tns-1

DIOPT Version :8

Sequence 1:NP_001033991.1 Gene:CG33993 / 3885637 FlyBaseID:FBgn0053993 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_491637.2 Gene:tns-1 / 172215 WormBaseID:WBGene00006508 Length:1354 Species:Caenorhabditis elegans

Alignment Length:643 Identity:128/644 (20%)
Similarity:197/644 (31%) Gaps:278/644 (43%)


  Fly    30 SQTAETTLIETAEKSPASEAAAGTVTTTS-------------PQHFFHHHHPPAH-PHPPRQQPH 80
            :|.|..|...|.::.|...|.:|:..|.:             |:::.:::...|. |.|.||:.|
 Worm   588 AQRAVITPTSTLQRRPKPPARSGSYRTLNDDAYCSDMDELCDPEYYLNYNSNTAPLPPPRRQEQH 652

  Fly    81 PHSHSHPHPHPQLQRRPV--------EQLHLLHSHHDVQELSG----QEHPHP------------ 121
            ..:.|...|..::....|        |....|.|.:.|.::.|    |:..|.            
 Worm   653 AGTRSVQLPRKKMNFDAVTDPLDDVLESTKRLGSAYSVGDVRGGQQQQQEQHNASNDFNFSNTLN 717

  Fly   122 ---------------QPGSHPHPHHLRSPSSEE--DNSPTEMN------NCRRLVDKPPLVKRLT 163
                           |..:.|..||..:||.|:  |.:.|.::      ..:|.:| |.:|:|.|
 Worm   718 NTPTDYRQHYRNRNCQSVTTPRNHHFSTPSREQEADAADTWLSGKLKKVRSKRDID-PDIVRRRT 781

  Fly   164 M----------------------------GIGL-------------------------------L 169
            .                            |.||                               :
 Worm   782 QEKMLLEELKDSAANNDENQHNLPNGHARGAGLQNIDPLAEFRREEERLRNTRSPYGEERWRGRM 846

  Fly   170 RGTEDSRPLMHSTCG--SSLTSGSGCGSTQTISDGYVNEAICEP----------DKYVASKFGDS 222
            ||...:.|...|:..  :||..|:   ....:.....|:::..|          |......|...
 Worm   847 RGKPPTPPPRESSASPVNSLPRGT---PAHHMDRQRHNQSVPLPMHHRQFDEDFDVNSLFNFSHD 908

  Fly   223 CRQSLSALESATQRL-------------QVELPA-----------ASKKYLRETC---------- 253
            .||..:.||...:.|             |.:|.|           |:..|..||.          
 Worm   909 PRQQSTTLERGGRSLSRGARIQDAYYASQQDLSANNRFNSGQERVAAAIYRAETAHRDMYASGTI 973

  Fly   254 ----------------------------------------------------------------- 253
                                                                             
 Worm   974 NRAETPGRYFPENSAVLERSSTPSFPVSRATPLPFHPLLYNNGERGGSGHAAGGGGGGHNGYSTM 1038

  Fly   254 -SANSSPKLFPGHSAL-RLDNLSLAEQQEL----------KGAAWFQAGIPREISLEALSRQSPG 306
             :.::||:||.|.|.| |..:::..:..|:          ....|::..|.||.::..|..:.||
 Worm  1039 NNRSASPRLFGGSSTLSRRSSVNSVDTSEIIHHHPLFVKDTSKYWYKPTISREQAINMLRDKPPG 1103

  Fly   307 AFLVRQSSTKPGCFALSLRV--PPP-------SPRVAHYLILRTQRGYKIKGFTKE--FSSLKAL 360
            .|:||.|::.||.|.|:|:|  |||       |..|.|:||..:.:|.|:||...|  |.||.||
 Worm  1104 TFVVRDSNSFPGAFGLALKVSTPPPGVNPGDGSELVRHFLIEPSPKGVKLKGCNNEPVFGSLSAL 1168

  Fly   361 ITHHSVMPELLPVPLTLP--RPPSTRSQRS-------QGA-----YAGG------TGN 398
            :..||:....||..|.||  .|.:|....|       |||     |.|.      |||
 Worm  1169 VYQHSITALALPTKLVLPDFDPAATPEHLSATQALLEQGAACNVVYVGSVDVESLTGN 1226

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33993NP_001033991.1 SH2 286..364 CDD:198173 35/89 (39%)
tns-1NP_491637.2 Hemocyanin_M <162..225 CDD:278784
PTEN_C2 211..335 CDD:287393
SH2_Tensin_like 1079..1189 CDD:198181 42/110 (38%)
PTB_tensin 1207..1348 CDD:269924 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45734
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.