DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34041 and AT5G66060

DIOPT Version :8

Sequence 1:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_201407.4 Gene:AT5G66060 / 836738 AraportID:AT5G66060 Length:289 Species:Arabidopsis thaliana

Alignment Length:153 Identity:25/154 (16%)
Similarity:58/154 (38%) Gaps:34/154 (22%)


  Fly   433 KDYNKSKEWLNVAISMLESSAYWDPIVPSADLYL-KLAEVYVKQ---------QNWTLALETVEF 487
            :|.:|::.|:.:......:|.|.:.:......|| :||:.::::         ::....:.|...
plant    69 EDDSKNERWVEIISWEPRASVYHNFLTKEECKYLIELAKPHMEKSTVVDEKTGKSTDSRVRTSSG 133

  Fly   488 ALKSNPRNAQLIRMQKRLS---------------YHILLGPPKSPKLNIENNDYRLRKNGSLYCF 537
            ...:..|:..:..::||:|               .|..:|....|..:...::|..|..|.    
plant   134 TFLARGRDKTIREIEKRISDFTFIPVEHGEGLQVLHYEIGQKYEPHYDYFMDEYNTRNGGQ---- 194

  Fly   538 YDTKIRTFYSLLAPIK--AEVLF 558
               :|.|....|:.::  .|.:|
plant   195 ---RIATVLMYLSDVEEGGETVF 214

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528
P4Ha_N 260..389 CDD:285528
TPR repeat 452..491 CDD:276809 7/49 (14%)
AT5G66060NP_201407.4 P4Hc 95..283 CDD:214780 20/128 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10869
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.