DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34041 and AT4G35810

DIOPT Version :10

Sequence 1:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_195306.2 Gene:AT4G35810 / 829735 AraportID:AT4G35810 Length:290 Species:Arabidopsis thaliana


Alignment Length:227 Identity:46/227 - (20%)
Similarity:76/227 - (33%) Gaps:73/227 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 VGKDPEVYLGNPLNSFS---------------LLHHLH-FDWPAWRKLMEKPL-ATEYITEIQE- 121
            :.|.|:.....|..|||               :|..|. |..|:..|....|: .|..:..||| 
plant     1 MAKKPKQLRNKPRKSFSTQTFTVVVLVLFVILILVGLGIFSLPSTNKTSSMPMDLTTIVQTIQER 65

  Fly   122 ------------MWSEM----P---------TKDEYTNSIKAAKDFHKNETQGNFEFSPLESLQI 161
                        .|.|:    |         |.:|..:.|..||.            |.::|..:
plant    66 ESFGDEEDGNGDRWLEVISWEPRAFVYHNFLTNEECEHLISLAKP------------SMMKSKVV 118

  Fly   162 AL---HAYDKKNYTEAENWLNITLNGYKNLSLQEKDLYEVLSPVIMVYDETNGAAMIAKSY---I 220
            .:   .:.|.:..|.:..:||   .|:..:   .:::...:|....:..| ||..:....|   .
plant   119 DVKTGKSIDSRVRTSSGTFLN---RGHDEI---VEEIENRISDFTFIPPE-NGEGLQVLHYEVGQ 176

  Fly   221 RYFSNHQM---EFIVMKSACILSVGLIIVYLS 249
            ||..:|..   ||.|.|..  ..:..:::|||
plant   177 RYEPHHDYFFDEFNVRKGG--QRIATVLMYLS 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:462433 22/105 (21%)
P4Ha_N 260..391 CDD:462433
LapB <435..>505 CDD:442196
TPR repeat 452..491 CDD:276809
AT4G35810NP_195306.2 PLN00052 75..289 CDD:177683 30/153 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.