DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34041 and AT4G35810

DIOPT Version :9

Sequence 1:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_001320148.1 Gene:AT4G35810 / 829735 AraportID:AT4G35810 Length:290 Species:Arabidopsis thaliana


Alignment Length:227 Identity:46/227 - (20%)
Similarity:76/227 - (33%) Gaps:73/227 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 VGKDPEVYLGNPLNSFS---------------LLHHLH-FDWPAWRKLMEKPL-ATEYITEIQE- 121
            :.|.|:.....|..|||               :|..|. |..|:..|....|: .|..:..||| 
plant     1 MAKKPKQLRNKPRKSFSTQTFTVVVLVLFVILILVGLGIFSLPSTNKTSSMPMDLTTIVQTIQER 65

  Fly   122 ------------MWSEM----P---------TKDEYTNSIKAAKDFHKNETQGNFEFSPLESLQI 161
                        .|.|:    |         |.:|..:.|..||.            |.::|..:
plant    66 ESFGDEEDGNGDRWLEVISWEPRAFVYHNFLTNEECEHLISLAKP------------SMMKSKVV 118

  Fly   162 AL---HAYDKKNYTEAENWLNITLNGYKNLSLQEKDLYEVLSPVIMVYDETNGAAMIAKSY---I 220
            .:   .:.|.:..|.:..:||   .|:..:   .:::...:|....:..| ||..:....|   .
plant   119 DVKTGKSIDSRVRTSSGTFLN---RGHDEI---VEEIENRISDFTFIPPE-NGEGLQVLHYEVGQ 176

  Fly   221 RYFSNHQM---EFIVMKSACILSVGLIIVYLS 249
            ||..:|..   ||.|.|..  ..:..:::|||
plant   177 RYEPHHDYFFDEFNVRKGG--QRIATVLMYLS 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528 22/105 (21%)
P4Ha_N 260..389 CDD:285528
TPR repeat 452..491 CDD:276809
AT4G35810NP_001320148.1 PLN00052 75..289 CDD:177683 30/153 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.