powered by:
Protein Alignment CG34041 and P4H5
DIOPT Version :9
| Sequence 1: | NP_001034077.5 |
Gene: | CG34041 / 3885583 |
FlyBaseID: | FBgn0054041 |
Length: | 568 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_179363.1 |
Gene: | P4H5 / 816281 |
AraportID: | AT2G17720 |
Length: | 291 |
Species: | Arabidopsis thaliana |
| Alignment Length: | 65 |
Identity: | 19/65 - (29%) |
| Similarity: | 32/65 - (49%) |
Gaps: | 11/65 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 216 AKSYIRY-----FSNHQMEFIVMKSACILSVGLIIV---YLSYSNSENRHSLSKSKVINILKIQE 272
:|.::|| .|.....|.|: ..:|.|.||:: .||..|: ||:|...:.:.||::..|
plant 5 SKQHLRYQPRKSVSRSTQAFTVL--ILLLVVILILLGLGILSLPNA-NRNSSKTNDLTNIVRKSE 66
Fly 273 272
plant 67 66
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1591 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
1 |
1.100 |
- |
- |
O |
PTHR10869 |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.910 |
|
Return to query results.
Submit another query.