DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34041 and P4H5

DIOPT Version :9

Sequence 1:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_179363.1 Gene:P4H5 / 816281 AraportID:AT2G17720 Length:291 Species:Arabidopsis thaliana


Alignment Length:65 Identity:19/65 - (29%)
Similarity:32/65 - (49%) Gaps:11/65 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 AKSYIRY-----FSNHQMEFIVMKSACILSVGLIIV---YLSYSNSENRHSLSKSKVINILKIQE 272
            :|.::||     .|.....|.|:  ..:|.|.||::   .||..|: ||:|...:.:.||::..|
plant     5 SKQHLRYQPRKSVSRSTQAFTVL--ILLLVVILILLGLGILSLPNA-NRNSSKTNDLTNIVRKSE 66

  Fly   273  272
            plant    67  66

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528
P4Ha_N 260..389 CDD:285528 3/13 (23%)
TPR repeat 452..491 CDD:276809
P4H5NP_179363.1 PLN00052 75..290 CDD:177683
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.