DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34041 and P4H5

DIOPT Version :10

Sequence 1:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_179363.1 Gene:P4H5 / 816281 AraportID:AT2G17720 Length:291 Species:Arabidopsis thaliana


Alignment Length:65 Identity:19/65 - (29%)
Similarity:32/65 - (49%) Gaps:11/65 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 AKSYIRY-----FSNHQMEFIVMKSACILSVGLIIV---YLSYSNSENRHSLSKSKVINILKIQE 272
            :|.::||     .|.....|.|:  ..:|.|.||::   .||..|: ||:|...:.:.||::..|
plant     5 SKQHLRYQPRKSVSRSTQAFTVL--ILLLVVILILLGLGILSLPNA-NRNSSKTNDLTNIVRKSE 66

  Fly   273  272
            plant    67  66

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:462433
P4Ha_N 260..391 CDD:462433 3/13 (23%)
LapB <435..>505 CDD:442196
TPR repeat 452..491 CDD:276809
P4H5NP_179363.1 PLN00052 75..290 CDD:177683
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.