DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34041 and zgc:152670

DIOPT Version :8

Sequence 1:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_001070123.2 Gene:zgc:152670 / 557059 ZFINID:ZDB-GENE-060929-954 Length:490 Species:Danio rerio

Alignment Length:349 Identity:77/350 (22%)
Similarity:124/350 (35%) Gaps:81/350 (23%)


  Fly   251 SNSENRHSLSKSKVINILKIQENVVKYLENYIYALETKLKTIDEALIDLATYHIQFERDKLAIAS 315
            |.:|.....|..:|..:...:||::.....||.|.|..||.:...|:.|........:.......
Zfish    17 SITEQEFFSSVDQVSQLFNEEENLLDTFSLYIDAEEENLKKMKSLLLLLQLGSFSNPQSPEETMR 81

  Fly   316 SPVASYSLIHHMQSDWTHWQLFLQEDPGKDELASLMSIKKYLPTKNDISEVCHGISKMLNAYLMT 380
            .|||::.|:..::.:|.:...|.|:.. ..|..:|:.. ..:|...||:....|:..:...|.:.
Zfish    82 DPVAAFKLLKRLRHEWVNIAKFTQQSL-YQEFQTLLDY-SLIPELEDINSAALGLIGLQEIYKLY 144

  Fly   381 AQDIANGVILGTQTKYISSALKLE-------YLYMEIICNRHLMSLRDCVALSDHSMEMKDYNKS 438
            ..:|.....|.....|....:..|       :|:.....||          |:|.|...|     
Zfish   145 PHNITKETPLSADEAYYIGLVAYEEDKFQHAFLWFLHSLNR----------LTDFSSTTK----- 194

  Fly   439 KEWLNVAISMLESSAYWDPIVPSADLYLKLAEVYVKQQNWTLALETVEFALKSNPRNAQ------ 497
                |..:..|.||||....:|.|        :|..|:           .|..:|.|.:      
Zfish   195 ----NDLLRFLSSSAYQFGSLPVA--------IYFGQK-----------LLNLDPSNEEIKVQLG 236

  Fly   498 ---LIRMQKRLSYHILLGPPKSPKLNIE-NNDYRL-----------RKNGSLYCFYDT---KIRT 544
               |||:|:..:       |....||.: ||.|..           ::..:|.|.|.|   ..|.
Zfish   237 LYRLIRLQRTSN-------PDIFTLNTQSNNSYEALCRGEVDERTSKRQRALSCRYSTGGGNPRL 294

  Fly   545 FYSLLAPIKAEVLFIDPLVILYHE 568
            .|   ||:|.|.|:.:|.:|.||:
Zfish   295 MY---APVKEEELWDEPKIIRYHD 315

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528
P4Ha_N 260..389 CDD:285528 27/129 (21%)
TPR repeat 452..491 CDD:276809 8/39 (21%)
zgc:152670NP_001070123.2 P4Ha_N 26..150 CDD:285528 27/126 (21%)
P4Hc 318..474 CDD:214780
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10869
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.