DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34041 and p4ha2

DIOPT Version :8

Sequence 1:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster
Sequence 2:XP_017947536.1 Gene:p4ha2 / 493342 XenbaseID:XB-GENE-957618 Length:557 Species:Xenopus tropicalis

Alignment Length:377 Identity:68/378 (18%)
Similarity:141/378 (37%) Gaps:73/378 (19%)


  Fly   226 HQMEFIVMKSACILSVGLIIVYLSYSNSENRHSLSKSKVINILKIQENVVKYLENYIYALETKLK 290
            |.:..:::...||..|            :.....|..::.:::..:.::::.|:.||...|.:|.
 Frog     4 HAISLLLLSLCCIWEV------------QTEVFTSTGQMTDLIFRERDLLQSLKEYIREEEERLS 56

  Fly   291 TIDEALIDLATYHIQFERDKLAIASSPVASYSLIHHMQSDWTHWQLFLQEDPGKDELASLMSIKK 355
            .|.....::.....:...|.......||.:|.|:....:||:..:..:.:|..|..:|:....::
 Frog    57 KIKRWASEVDELSSRSTADPEGYLGHPVNAYKLVKRFNTDWSSLENLVLQDSAKGFIANFTFQRE 121

  Fly   356 YLPTKNDISEVCHGISKMLNAYLMTAQDIANGVILGTQTKYISSALKLEYLYMEIICNRHLMSLR 420
            |.||:.|.:.....:.::.:.|.:....||.|.:.|  |.||||                 :|..
 Frog   122 YFPTEEDETGAARALMRIQDTYKLDPDVIAKGKLPG--TNYISS-----------------LSAD 167

  Fly   421 DCVALSDHSMEMKDYNKSKEWLNVAISMLESSAYWDPIVPSADLYLKLAEVYVKQQNWTLALETV 485
            |...:...:....||..:..|:..|:..::...  |.:|...|:...|:....:..:...|||..
 Frog   168 DSFGMGKIAYHDGDYYHTVLWMQQALKQMDEGE--DAVVNKVDVLDYLSYTVFQLGDVPRALELT 230

  Fly   486 EFALKSNPRNAQLI-------RMQKRLSYHILLGPPKSPKLNIENN-----------DY------ 526
            :..|..:|.:.:.:       :||::....:    .::...|.|:.           ||      
 Frog   231 KRLLVLDPNHDRAVNNLKYFEKMQEKQKAEL----KQNESTNTESATRQPGVYSRPLDYLPERDV 291

  Fly   527 ------------RLRKNGSLYCFYDTKIRTFYSLLAPIKAEVLFIDPLVILY 566
                        ..|:...|:|.|....|:.|.:|:|:|.|..:..|.::.|
 Frog   292 YEALCRGEGVKMNPRRQRRLFCRYHNGNRSPYLILSPVKVEDEWDSPRIVRY 343

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528
P4Ha_N 260..389 CDD:285528 25/129 (19%)
TPR repeat 452..491 CDD:276809 8/39 (21%)
p4ha2XP_017947536.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.737 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.