DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34041 and PH4alphaPV

DIOPT Version :9

Sequence 1:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_733395.1 Gene:PH4alphaPV / 43640 FlyBaseID:FBgn0051015 Length:525 Species:Drosophila melanogaster


Alignment Length:349 Identity:80/349 - (22%)
Similarity:167/349 - (47%) Gaps:43/349 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 ILSVGLIIVYLSYSNSENRHSLSKSKVINILKIQENVVKYLENYIYALETKLKTIDEALIDLATY 302
            :|:..::::.|..:..|..|..|.:.::.:|.::..::..||:|...||.||:|:..::..|   
  Fly    13 LLTYQVLLLLLRQAKGEESHCTSVAGMVKLLDLEAQLIDNLEDYAVELEKKLQTVRRSITSL--- 74

  Fly   303 HIQFERDKLAIA-----SSPVASYSLIHHMQSDWTHWQLFLQEDPGKDELASLMSIKKYLPTKND 362
              :.|.||...:     |:|:.|:|||..|..||..|||::.:..|..::..:..:::::||..|
  Fly    75 --RLENDKARSSTEEYLSNPLNSFSLIRRMNRDWIIWQLYMDDPVGISQVERIQELREHMPTHTD 137

  Fly   363 ISEVCHGISKMLNAYLMTAQDIANGVILGTQTKYISSALKLEYLYMEIICNRHLMSLRDCVALSD 427
            :.|....:.::.:.|.:...:|::|.:.|.|  |..|                 :::.|..|:..
  Fly   138 VEEAVTALDRIQSTYGLKVPEISHGFLNGKQ--YNVS-----------------LTVLDTYAMGQ 183

  Fly   428 HSMEMKDYNKSKEWLNVAISMLESSAYWDPI-VPSADLYLKLAEVYVKQQNWTLALETVEFALKS 491
            ...:.|:|..:..|:..::.::|:.:...|: :...::.:..||..:|......||:.|..||..
  Fly   184 ILFDQKNYLAAASWIYQSVVLMEAFSMAAPLEISKNEVRMVYAETLLKLNQHADALKVVNIALTD 248

  Fly   492 NPRNAQLIRMQKRLSYHILLGPPKSPKLNIENND----YRLRKNG--------SLYCFYDTKIRT 544
            ||.:.:|:..:..:...|..|...:|.:.::...    |::...|        .|||.|:.....
  Fly   249 NPHDIKLLLKKSEIETMIRTGTNNAPPVKVQATGVPTAYQIGCRGQFPPSADSKLYCLYNRTTSP 313

  Fly   545 FYSLLAPIKAEVLFIDPLVILYHE 568
            |. :|||:|.|::.:||.::|||:
  Fly   314 FL-ILAPLKMELVGLDPYMVLYHD 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528
P4Ha_N 260..389 CDD:285528 34/133 (26%)
TPR repeat 452..491 CDD:276809 9/39 (23%)
PH4alphaPVNP_733395.1 P4Ha_N 35..164 CDD:285528 34/133 (26%)
TPR_11 179..250 CDD:290150 14/70 (20%)
TPR repeat 179..213 CDD:276809 5/33 (15%)
TPR repeat 218..248 CDD:276809 8/29 (28%)
P4Hc 339..510 CDD:214780
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461969
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.