DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34041 and PH4alphaNE1

DIOPT Version :8

Sequence 1:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_733374.1 Gene:PH4alphaNE1 / 43625 FlyBaseID:FBgn0039780 Length:537 Species:Drosophila melanogaster

Alignment Length:371 Identity:80/372 (22%)
Similarity:152/372 (41%) Gaps:77/372 (21%)


  Fly   238 ILSVGLIIVYLSYSNSENRHSLSKSKVINILKIQENVVKYLENYIYALETKLKTIDEALIDLATY 302
            :|.||||.: |:..:..:.:..|.:.:.::|..::.:.:.|.:.:.|::|.|:.::..|..:...
  Fly     5 VLLVGLIFL-LAQGSLASDYFSSITGLEDLLHTEQYLTRELRSKVNAIQTALQQLESELSSIEKE 68

  Fly   303 HIQFERDKLAIASSPVASYSLIHHMQSDWT----HWQLFLQEDPGKDELASLMSIKKY---LPTK 360
            |.....|.....::||..|.|:..:.:||:    ..||..:|       .:..:.::|   .|::
  Fly    69 HTMAASDTENYLTNPVNVYRLMKRLHTDWSLMEGRVQLMAEE-------MNFNATREYGLSYPSQ 126

  Fly   361 NDISEVCHGISKMLNAYLMTAQDIANGVILGTQTKYISSALKLEYLYMEIICNRHLMSLRDCVAL 425
            .|:......:.::.:.|.:....:|.|::.|  .||.|.                 ||.:||..|
  Fly   127 EDVEGAALALVRLQSTYKLDVAQVAQGILNG--VKYGSD-----------------MSWQDCFEL 172

  Fly   426 SDHSMEMKDYNKSKEWLNVAISMLESSAYWDP--IVPSA---DLYLKLAEVYVKQ----QNWTLA 481
            .....||:|||.:|.||..::..|.......|  :.|::   .:.|...|...|.    .::..|
  Fly   173 GQQLFEMEDYNNTKVWLRESMERLRRQTSHAPSHLAPTSGPDTVTLNKMEATAKSLFQLGDFDTA 237

  Fly   482 LETVEFALKSNPRNAQLIRMQKRLSYHILLG-----PPKS------PK------LNIENNDYRLR 529
            .|..:..|:.:|:..:        ::|  ||     ||:.      ||      |:.|...|...
  Fly   238 FELSQRVLQFDPKRIR--------NWH--LGDKGTAPPEDIDDVYLPKHSDSYSLSQEFAKYEKV 292

  Fly   530 KNGSLYCFYDTKIRTFYS-------LLAPIKAEVLFIDPLVILYHE 568
            ..|.::.....::|..||       .|||:|.|...:||.|..:|:
  Fly   293 CRGEVHPIVRQELRCRYSRGNHPYRFLAPLKLEEHSLDPYVATFHD 338

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528
P4Ha_N 260..389 CDD:285528 24/136 (18%)
TPR repeat 452..491 CDD:276809 8/48 (17%)
PH4alphaNE1NP_733374.1 P4Ha_N 26..155 CDD:285528 24/136 (18%)
P4Hc 341..511 CDD:214780
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C146332851
eggNOG 1 0.900 E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10869
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.