DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34041 and PH4alphaMP

DIOPT Version :8

Sequence 1:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_524594.2 Gene:PH4alphaMP / 43624 FlyBaseID:FBgn0026190 Length:535 Species:Drosophila melanogaster

Alignment Length:368 Identity:76/369 (21%)
Similarity:159/369 (43%) Gaps:66/369 (18%)


  Fly   232 VMKSACILSVGLIIVYLS-----YSNSENRHSLSKSKVINILKIQENVVKYLENYIYALETKLKT 291
            ::.:.|:|.  |::..||     :|::.....|.:::|:.:.::| |.|..:..:..||::::..
  Fly     1 MLLAKCVLF--LVLQVLSCHGEFFSSTSGLAKLFETEVVLLAELQ-NYVNEINQHAEALQSEIDA 62

  Fly   292 IDEALIDLATYHIQFERDKLAIASSPVASYSLIHHMQSDWTHWQLFLQEDPGKDE-LASLMSIKK 355
            |       ...|:..........::||.::.||..:.|||..::..:..|..:.. |.::.|:|:
  Fly    63 I-------RVEHLNAADGIDDYLNNPVNAFRLIKRLHSDWETFEGSVTADSSRSNYLDTMASLKE 120

  Fly   356 YL--PTKNDISEVCHGISKMLNAYLMTAQDIANGVILGTQTKYISSALKLEYLYMEIICNRHLMS 418
            .|  |:::|.......::::...|.:...::|:|::.|  .||.::                 ||
  Fly   121 NLSFPSQDDFVGSAIALTRLQQTYQLDVAELASGILNG--VKYGTA-----------------MS 166

  Fly   419 LRDCVALSDHSMEMKDYNKSKEWLNVAISMLESSAYWDPIVPSADLYLKLAEVYVKQQNWTLALE 483
            .:||..|..|...::|||.:..||..::.:|...:|..... |.|....:.|.:.:......||.
  Fly   167 WQDCFVLGQHLYALRDYNHTVPWLQQSMQLLGEQSYGSESA-SLDFMEAVVEYHREMGAHESALS 230

  Fly   484 TVEFALKSNP-RNAQLIRMQKRLSYHILLGPPKSPKLNI---------ENNDYRL---------- 528
            .|...|...| :.:.|:..:::|. .::....|:..|::         |:.::|:          
  Fly   231 LVNHVLSIEPDQRSHLLEARQQLE-ELITDGDKNGLLHLTARRPGDYHESREFRMYEQVCRGELA 294

  Fly   529 ---RKNGSLYCFYDTKIRTFYSLLAPIKAEVLFIDPLVILYHE 568
               .|..:|.|    ::|......||.|.|.|.:||||:..|:
  Fly   295 PLPSKQRNLRC----RLRKSRLGYAPFKLEELHLDPLVVQLHQ 333

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528
P4Ha_N 260..389 CDD:285528 25/132 (19%)
TPR repeat 452..491 CDD:276809 8/39 (21%)
PH4alphaMPNP_524594.2 P4Ha_N 24..156 CDD:285528 26/140 (19%)
P4Hc 336..509 CDD:214780
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C146332884
eggNOG 1 0.900 E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10869
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.