DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34041 and PH4alphaSG2

DIOPT Version :9

Sequence 1:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_651801.1 Gene:PH4alphaSG2 / 43623 FlyBaseID:FBgn0039779 Length:527 Species:Drosophila melanogaster


Alignment Length:366 Identity:80/366 - (21%)
Similarity:153/366 - (41%) Gaps:78/366 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 LSVGL--IIVYLSYSNSENRHSLSKSKVINILKIQENVVKYLENYIYALETKLKTIDEALIDLAT 301
            |.:|:  :|:::..:|.|...|:...:  ::.:::|.::....:|:   |::.|.:|    ....
  Fly     7 LYIGIFQLIIWVGVANGEFYSSVDSMQ--DLAQVEEELLNATRSYV---ESQQKQLD----FYRR 62

  Fly   302 YHIQFERDKLAIASS---------PVASYSLIHHMQSDWTH--WQLFLQEDPGKDELASLMSIKK 355
            |..|.:|:.....|.         |:.::.||..:..||..  ::..|..:..::..|.:..:.:
  Fly    63 YVEQIKREHEWATSQLKLDDYLGHPLHAFRLIKRLVRDWDSLIFEPILANNAREEFRAFVEVLSR 127

  Fly   356 YL--PTKNDISEVCHGISKMLNAYLMTAQDIANGVILGTQTKYISSALKLEYLYMEIICNRHLMS 418
            .|  |.::::.....|::::...|.:...|:|:|:|.|  ..|.|.                 :.
  Fly   128 DLGYPDQSELQGAIKGLARLQKVYNLATSDLADGIIGG--LNYGSD-----------------LR 173

  Fly   419 LRDCVALSDHSMEMKDYNKSKEWLNVAISMLESSAYWDPIVPSADLYLKLAEVYVKQQNWTL--- 480
            .|:|..:.....::.:|.:|.|||.||..:|.:|...:   ..||.||.....|....|:.|   
  Fly   174 WRECYEIGVQLFDLGEYQRSLEWLQVAFILLRNSPREE---KDADHYLSDIREYASMANFELGNP 235

  Fly   481 --ALETVEFALKSNP-RNAQLIRMQKRLSYHILLGPPKSPKLNIE-------NNDYRL------- 528
              |...:...|:|.| .:||  :.||.|...:       |..|::       :|..||       
  Fly   236 KKAARLLSQILESQPTHSAQ--QTQKYLESRV-------PGKNVQETKPSWFSNYTRLCQGRRLP 291

  Fly   529 --RKNGSLYCFYDTKIRTFYSLLAPIKAEVLFIDPLVILYH 567
              |....|.|:.|.| |..|..|||::.|.:.:||.:.:||
  Fly   292 EERSGDPLRCYLDGK-RHAYFTLAPLQVEPVHLDPDINVYH 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528
P4Ha_N 260..389 CDD:285528 23/141 (16%)
TPR repeat 452..491 CDD:276809 10/43 (23%)
PH4alphaSG2NP_651801.1 P4Ha_N 28..163 CDD:285528 24/143 (17%)
P4Hc 335..503 CDD:214780
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461979
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.