DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34041 and CG18231

DIOPT Version :9

Sequence 1:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_649045.2 Gene:CG18231 / 40026 FlyBaseID:FBgn0036796 Length:470 Species:Drosophila melanogaster


Alignment Length:345 Identity:88/345 - (25%)
Similarity:148/345 - (42%) Gaps:74/345 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 SKSKVINILKIQENVVKYLENYIYALETKLKTIDEALIDLATYHIQ--FERDKLAIASSPVASYS 322
            |.::::.:|:::|..:..::.|...|..|:|.: :|.||...|..|  || |:.....:|:.::|
  Fly    19 SITRLLKLLEMEEIFITNIKAYTNKLAEKVKNL-QAYIDSVDYEFQQSFE-DREKYVGNPINAFS 81

  Fly   323 LIHHMQSDWTHWQLFLQEDPGKDELASLMSIKKYLPTKNDISEVCHGISKMLNAYLMTAQDIANG 387
            |:.....|...|..:.|:..|.:||.:|..|...:|.|.|::.....:.::...|.:.|.::|.|
  Fly    82 LVRRTHQDLPKWHNYSQQIVGMEELFALEEIIAKVPDKKDMAYSLGEMHRIEQIYDLEAIELARG 146

  Fly   388 VILGTQTKYISSALKLEYLYMEIICNRHLMSLRDCVALSDHSMEMKDYNKSKEWLNVAI------ 446
            .|.|.|..:                   ..|:||||||.:|..:.:||.::..|..|||      
  Fly   147 RIQGKQYDF-------------------RPSIRDCVALGEHKFKREDYQRASMWFRVAIKHEPEG 192

  Fly   447 -SMLESSAYWDPIVPSADLYLKLAEVYVKQQNWTLALETVEFALKSNPRNAQLIRMQKRLSYHIL 510
             :.:.:|...||.|....||.|...::              ..:||||  :..|...|::||..|
  Fly   193 NAEIINSILGDPKVNLYTLYAKSMLIF--------------GMIKSNP--SMTIAEAKKISYEAL 241

  Fly   511 ----LGPPKS--------------PKLNIEN---NDYRLRKNGSL------YCFYDTKIRTFYSL 548
                |...||              .::|:..   :||.:...|..      .|.|:..|..|.. 
  Fly   242 NKASLADIKSLLNELLSQTDDEIVYEMNVNKTKPSDYEIGCRGQFLRRRNHVCTYNFTITEFLK- 305

  Fly   549 LAPIKAEVLFIDPLVILYHE 568
            |||:|.|||..||.:::||:
  Fly   306 LAPLKQEVLNWDPYIVIYHD 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528
P4Ha_N 260..389 CDD:285528 33/130 (25%)
TPR repeat 452..491 CDD:276809 7/38 (18%)
CG18231NP_649045.2 P4Ha_N 19..148 CDD:285528 33/130 (25%)
2OG-FeII_Oxy 322..449 CDD:304390 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461987
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.