DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34041 and PH4alphaNE3

DIOPT Version :8

Sequence 1:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_651814.1 Gene:PH4alphaNE3 / 326114 FlyBaseID:FBgn0051017 Length:481 Species:Drosophila melanogaster

Alignment Length:348 Identity:71/349 (20%)
Similarity:139/349 (40%) Gaps:76/349 (22%)


  Fly   252 NSENRHSL--SKSKVINILKIQENVVKYLENYIYALETKLKTIDEALIDL-ATYHIQFERDKLAI 313
            |.|:|...  ::|..::::::...::..|.||...::.|...:.....:| ...|....|:: ..
  Fly    10 NWESRQEFLDTESAKMDLMQLDVELIDNLMNYAEKIDEKASQLKRLAQELRQPLHSAKGREE-EY 73

  Fly   314 ASSPVASYSLIHHMQSDWTHWQLFLQEDPGKDELASLMSIKKYLPTKNDISEVCHGISKMLNAYL 378
            ..:|:.|:.||.||..||.:.:.|:::..|::|:..|......||.:.|..|....|.::...|.
  Fly    74 LGNPLHSFPLIRHMYQDWRYLEEFMKKPVGEEEIQFLRRKLPELPWQVDTEEASVSIFRIAETYG 138

  Fly   379 MTAQDIANGVILGTQTKYISSALKLEYLYMEIICNRHLMSLRDCVALSDHSMEMKDYNKSKEWLN 443
            |...|:|||:|...:......||                   ||..::....:...:.::.:|:.
  Fly   139 MMPWDMANGLIDNVRFNSTLPAL-------------------DCFEVAKMYFKWGYFKQALQWIT 184

  Fly   444 VAISMLESSAYWDPIVPSADLYLKLAEVYVKQQNWTLALETVEFALKSNPRNAQLIRMQKRLSYH 508
            ::.:.::..            |..:.||        |.:...:.||.   :...|:.:.:|...|
  Fly   185 ISKARMKEE------------YSGVYEV--------LGMNRQDVALL---QARCLVELDRRDEAH 226

  Fly   509 -ILLGPP----------------------KSPKLNIENNDYRLRKNGS-----LYCFYDTKIRTF 545
             :||..|                      .||||. |......|.:.|     |:|.|::....|
  Fly   227 EVLLDQPDLADNSISLLDQFKANPYEAIDSSPKLG-EGYKRLCRSSFSPNPSKLHCRYNSTTSAF 290

  Fly   546 YSLLAPIKAEVLFIDPLVILYHE 568
            . :|||:|.|.:.::|.:::||:
  Fly   291 L-ILAPLKMEEISLEPHIVVYHD 312

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528
P4Ha_N 260..389 CDD:285528 31/130 (24%)
TPR repeat 452..491 CDD:276809 6/39 (15%)
PH4alphaNE3NP_651814.1 P4Ha_N 25..149 CDD:285528 30/125 (24%)
P4Hc 316..478 CDD:214780
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C146332673
eggNOG 1 0.900 E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10869
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.