DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34041 and P4htm

DIOPT Version :8

Sequence 1:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster
Sequence 2:XP_001075237.3 Gene:P4htm / 301008 RGDID:1311848 Length:553 Species:Rattus norvegicus

Alignment Length:308 Identity:65/309 (21%)
Similarity:112/309 (36%) Gaps:96/309 (31%)


  Fly    13 LGFSPLLAVLILPKWASSTKMKAYLDLDTRLKTQLRGY-------SEDLQDHISTLNRYIDDRKS 70
            |...|||  ..:|.:.|..:.:..:.|     .|::|.       :|:.::.:|.:      |.|
  Rat   189 LSLKPLL--FEIPGFLSDEECRLIIHL-----AQMKGLQRSQILPTEEYEEAMSAM------RVS 240

  Fly    71 ELDKVGKDPEVYLGNPLNSFSLLHHLHFDWPAWRKLMEKPLAT------EYIT--EIQEMWSEM- 126
            :||               .|.||...|    ..|..:.:.||.      .::|  .||||:|.: 
  Rat   241 QLD---------------LFQLLDQNH----DGRLQLREVLAQTRLGNGRWMTPENIQEMYSAIK 286

  Fly   127 --PTKD------EYTNSIKAAKDFHKNETQGNFEFSPL--ESLQIALHAYDKKNYTE---AENWL 178
              |..|      |::|  ...:||||.......|.|.|  .|....||..:..::..   .:..|
  Rat   287 ADPDGDGVLSLQEFSN--MDLRDFHKYMRSHKAESSELVRNSHHTWLHQGEGAHHVMRAIRQRVL 349

  Fly   179 NITLNGYKNLSLQEKDLYEVLSPVIM--------------VYDETNGAAMIAKSYIRYFSNHQME 229
            .:|     .||.:..:|.|.|..|..              ||.||      ..|:.:..:|..:.
  Rat   350 RLT-----RLSPEIVELSEPLQVVRYGEGGHYHAHVDSGPVYPET------VCSHTKLVANESVP 403

  Fly   230 FIVMKSACILSVGLIIVYLS--YSNSENRHSLSKSKVINILK-IQENV 274
            |   :::|....  ::.||:  ....|....::.::..:.:. ||:||
  Rat   404 F---ETSCRYMT--VLFYLNNVTGGGETVFPVADNRTYDEMSLIQDNV 446

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528 27/133 (20%)
P4Ha_N 260..389 CDD:285528 4/17 (24%)
TPR repeat 452..491 CDD:276809
P4htmXP_001075237.3 EF-hand_7 243..303 CDD:290234 18/81 (22%)
EFh 245..303 CDD:298682 17/64 (27%)
P4Hc 297..509 CDD:214780 35/169 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92090871
eggNOG 1 0.900 E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.