DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG34041 and phy-4

DIOPT Version :9

Sequence 1:	NP_001034077.5	Gene:	CG34041 / 3885583	FlyBaseID:	FBgn0054041	Length:	568	Species:	Drosophila melanogaster
Sequence 2:	NP_001123049.1	Gene:	phy-4 / 189869	WormBaseID:	WBGene00012815	Length:	282	Species:	Caenorhabditis elegans

Alignment Length:	38	Identity:	12/38 - (31%)
Similarity:	19/38 - (50%)	Gaps:	6/38 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly   530 KNGSLYCFYDTKIRTFYSLLAPIKAEVLFIDPLVILYH 567
            ::|.|.|:     |....||.. |.|:|..:|.::.||
Worm    46 RDGRLVCY-----RLHKHLLIR-KVEILSSEPFILQYH 77

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID
CG34041	NP_001034077.5	P4Ha_N	29..138	CDD:285528
		P4Ha_N	260..389	CDD:285528
		TPR repeat	452..491	CDD:276809
phy-4	NP_001123049.1	P4Hc	81..254	CDD:214780
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR10869
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	2.010