DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34041 and p4ha1b

DIOPT Version :9

Sequence 1:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_999856.1 Gene:p4ha1b / 100003675 ZFINID:ZDB-GENE-030131-4089 Length:536 Species:Danio rerio


Alignment Length:362 Identity:78/362 - (21%)
Similarity:142/362 - (39%) Gaps:80/362 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 SENRHSLSKSKVINILKIQENVVKYLENYIYALETKLKTIDEALIDLATYHIQFERDKLAIASSP 317
            :.|....|..::.::|..::::|..|:.||...|.:|:.:.|....|.:..|...:|.......|
Zfish    17 AHNDFFTSTGQMTDLLYAEKDLVTSLKEYIKQEENRLEQVKEWADKLDSLTITATQDPEGFLGHP 81

  Fly   318 VASYSLIHHMQSDWTHWQLFLQEDPGKDELASLMSIKKYLPTKNDISEVCHGISKMLNAYLMTAQ 382
            |.::.|:..:.|:|:..:..:.:|.....:::|...::|.||..|.:.....:.::.:.|.::|.
Zfish    82 VNAFKLMKRLNSEWSDLENLVLKDTTNGFISNLTVQRQYFPTDEDQTGAAKALLRLQDTYQLSAN 146

  Fly   383 DIANGVILGTQTKYISSALKLEYLYMEIICNRHLMSLRDCVALSDHSMEMKDYNKSKEWLNVAIS 447
            .|::|.:.|                   :.::..|::.||..|...:....||..::.|:..|:|
Zfish   147 AISSGDLPG-------------------VVHKSRMTVEDCYELGKIAYSDADYYHTELWMAQALS 192

  Fly   448 MLESSAYWDPI--VPSADLYLKLAEVYVKQQNWTLALETVEFALKSNP----------------- 493
            .|:.... .||  |...| ||..| :| :|.....|||..:..||.:|                 
Zfish   193 QLDEGEE-SPIDKVTVMD-YLSYA-IY-QQGELDRALELTKRMLKLDPNHHRANGNLKYFEFQLE 253

  Fly   494 --------------------RNAQLIR----MQKRLSYHILL---GPPKSPKLNIENNDYRLRKN 531
                                |:||..|    :.:|..|..|.   |...:|           |:.
Zfish   254 KQRKAENEKKEEDQKRVLDKRDAQRKRSKDPLPERKKYERLCRGEGIKLTP-----------RRQ 307

  Fly   532 GSLYCFYDTKIRTFYSLLAPIKAEVLFIDPLVILYHE 568
            ..|:|.|....|....||||:|.|..:..|.::.|||
Zfish   308 SRLFCRYSNNNRNPRLLLAPVKQEDEWDRPRIVRYHE 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528
P4Ha_N 260..389 CDD:285528 27/128 (21%)
TPR repeat 452..491 CDD:276809 13/40 (33%)
p4ha1bNP_999856.1 P4Ha_N 24..153 CDD:285528 27/128 (21%)
TPR repeat 164..199 CDD:276809 9/34 (26%)
TPR_16 168..238 CDD:290168 22/73 (30%)
TPR repeat 204..234 CDD:276809 11/32 (34%)
P4Hc 347..520 CDD:214780
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.