| Sequence 1: | NP_001034048.2 | Gene: | Octbeta3R / 3885573 | FlyBaseID: | FBgn0250910 | Length: | 1256 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001024339.1 | Gene: | ser-2 / 182110 | WormBaseID: | WBGene00004777 | Length: | 455 | Species: | Caenorhabditis elegans |
| Alignment Length: | 31 | Identity: | 11/31 - (35%) |
|---|---|---|---|
| Similarity: | 14/31 - (45%) | Gaps: | 0/31 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 247 SENQNQDPETELQEDMCTFERQNNAYQKIEN 277 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Octbeta3R | NP_001034048.2 | 7tmA_DmOct-betaAR-like | 142..>338 | CDD:320194 | 11/31 (35%) |
| TM helix 1 | 142..167 | CDD:320194 | |||
| TM helix 2 | 174..200 | CDD:320194 | |||
| TM helix 3 | 213..243 | CDD:320194 | |||
| TM helix 4 | 255..278 | CDD:320194 | 7/23 (30%) | ||
| TM helix 5 | 302..331 | CDD:320194 | |||
| 7tm_GPCRs | <1161..1234 | CDD:475119 | |||
| TM helix 6 | 1167..1189 | CDD:410628 | |||
| TM helix 7 | 1202..1227 | CDD:410628 | |||
| ser-2 | NP_001024339.1 | 7tmA_tyramine_octopamine_R-like | 58..434 | CDD:320188 | 11/31 (35%) |
| TM helix 1 | 59..85 | CDD:320188 | |||
| TM helix 2 | 92..118 | CDD:320188 | 4/8 (50%) | ||
| TM helix 3 | 131..161 | CDD:320188 | 3/9 (33%) | ||
| TM helix 4 | 173..196 | CDD:320188 | |||
| TM helix 5 | 214..243 | CDD:320188 | |||
| TM helix 6 | 362..392 | CDD:320188 | |||
| TM helix 7 | 402..427 | CDD:320188 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||