DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and ser-2

DIOPT Version :10

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_001024339.1 Gene:ser-2 / 182110 WormBaseID:WBGene00004777 Length:455 Species:Caenorhabditis elegans


Alignment Length:31 Identity:11/31 - (35%)
Similarity:14/31 - (45%) Gaps:0/31 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 SENQNQDPETELQEDMCTFERQNNAYQKIEN 277
            ||..|..|.|..|..:....||..|.::.||
 Worm   109 SELLNSTPATHPQSSISLAPRQTIATRRAEN 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tmA_DmOct-betaAR-like 142..>338 CDD:320194 11/31 (35%)
TM helix 1 142..167 CDD:320194
TM helix 2 174..200 CDD:320194
TM helix 3 213..243 CDD:320194
TM helix 4 255..278 CDD:320194 7/23 (30%)
TM helix 5 302..331 CDD:320194
7tm_GPCRs <1161..1234 CDD:475119
TM helix 6 1167..1189 CDD:410628
TM helix 7 1202..1227 CDD:410628
ser-2NP_001024339.1 7tmA_tyramine_octopamine_R-like 58..434 CDD:320188 11/31 (35%)
TM helix 1 59..85 CDD:320188
TM helix 2 92..118 CDD:320188 4/8 (50%)
TM helix 3 131..161 CDD:320188 3/9 (33%)
TM helix 4 173..196 CDD:320188
TM helix 5 214..243 CDD:320188
TM helix 6 362..392 CDD:320188
TM helix 7 402..427 CDD:320188
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.