DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and AgaP_AGAP005688

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_001688707.1 Gene:AgaP_AGAP005688 / 5667341 VectorBaseID:AGAP005688 Length:301 Species:Anopheles gambiae


Alignment Length:264 Identity:76/264 - (28%)
Similarity:122/264 - (46%) Gaps:47/264 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 DYLPT------------RIVNGKKIKCSRAPYQCAL---HYNNYFICGCVILNRRWILTAQHCKI 117
            |.|||            ||.||::....:.|||..|   ......:||..:|.|.:||||.||.:
Mosquito    38 DRLPTEMKIYRQRRPFQRITNGQEATPGQFPYQIILLSDFPTGTALCGGSVLTRNFILTAAHCVV 102

  Fly   118 GNPGRYTVRAG--------------STQQRRGGQLRHVQKTV-CHPNYSEYTMKNDLCMMKLKTP 167
            .  |..||.:|              ::|||    :|:....: .||.|...|::.|:.::.|.:.
Mosquito   103 S--GTNTVVSGGIAIMGAHNRTIQEASQQR----IRYTASGIRYHPLYVSSTLRYDIAVVLLNSS 161

  Fly   168 LNVGRCVQKVKLPS-TRTKRFPKCY-LASGWGLTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGT 230
            :.....:|.|:||: :.|::|.... ..||:|.|:..:|::...:|......::.|.|...:..:
Mosquito   162 ITFTDRIQPVRLPAQSDTRQFGGFVGTLSGFGRTTDASQSISTVVRFTSNPVMTNANCITRWGSS 226

  Fly   231 GIKIYKQMIC-AKRKNRDTCSGDSGGPL-VHNG--VLYGITSFGI--GCASAKYPGVYVNVLQYT 289
            .|:  .|.:| :....|.:|:||||||| |.:|  :..|:.||..  || .|..|.||..|..|.
Mosquito   227 NIQ--DQNVCLSGTGGRSSCNGDSGGPLTVESGGPIQIGVVSFVSIRGC-EAGMPSVYSRVSFYL 288

  Fly   290 RWIK 293
            .|::
Mosquito   289 NWVE 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 71/244 (29%)
Tryp_SPc 74..295 CDD:238113 71/246 (29%)
AgaP_AGAP005688XP_001688707.1 Tryp_SPc 55..291 CDD:214473 71/244 (29%)
Tryp_SPc 56..292 CDD:238113 71/244 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.