DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and AgaP_AGAP006485

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_001688885.1 Gene:AgaP_AGAP006485 / 5667297 VectorBaseID:AGAP006485 Length:281 Species:Anopheles gambiae


Alignment Length:265 Identity:74/265 - (27%)
Similarity:118/265 - (44%) Gaps:44/265 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 PAINA--LEAQDYLPTRIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHC------ 115
            |.|..  :|::|..| |::.|......:.|...:::......||..:::|:.:|||..|      
Mosquito    15 PCIRGDNVESEDRSP-RLIGGTNAPWGQFPSAVSINTTFNVHCGGAVVDRQHVLTAAQCVFNANL 78

  Fly   116 KIGNPGRYTVRAGSTQQRRGG---QLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKV 177
            ::.:|...|||||.......|   |.|.|.....||.::..|:::|:.:::|..|.:        
Mosquito    79 RLVDPYWITVRAGDIALAPVGARRQTRKVSHIFVHPQFNIRTLEHDVAVLRLDRPYD-------- 135

  Fly   178 KLPS------TRTKRF----PKCYLASGWGLTSA--NAQ-NV-QRYLRGVIVCKVSRAKCQQDYR 228
             |||      .||:|.    ..|..| |||.::|  ||. || ||:|...:   ..|..|.|...
Mosquito   136 -LPSNTINLANRTRRIVPNGASCQFA-GWGASTAALNAPVNVLQRFLPMTV---NDRDMCNQANM 195

  Fly   229 GTGIKIYKQMICAKR----KNRDTCSGDSGGPLVHNGVLYGITSFGIGCASAKYPGVYVNVLQYT 289
            ..| ::.:..:||..    .|...|:|::|..|.....|.|..|||:.|.:|..|.|:..|..|.
Mosquito   196 HAG-RMLESHLCAGNTGGSNNAAPCNGNAGTGLYCERALVGTLSFGLNCGAANNPPVFTQVRFYN 259

  Fly   290 RWIKK 294
            .||::
Mosquito   260 DWIER 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 67/245 (27%)
Tryp_SPc 74..295 CDD:238113 68/248 (27%)
AgaP_AGAP006485XP_001688885.1 Tryp_SPc 30..262 CDD:214473 67/245 (27%)
Tryp_SPc 32..265 CDD:238113 68/247 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.