DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and AgaP_AGAP010614

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_001237580.2 Gene:AgaP_AGAP010614 / 4577723 VectorBaseID:AGAP010614 Length:266 Species:Anopheles gambiae


Alignment Length:228 Identity:77/228 - (33%)
Similarity:101/228 - (44%) Gaps:27/228 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 RIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHCKI---GNPGRYTVRAGSTQQRR 134
            ||||||.:...:..|..:|..|..|.||..|:.....|||.||..   .:|.|.|:..|||....
Mosquito    36 RIVNGKAVSIVKYKYALSLRVNGVFDCGATIITNSHSLTAAHCVYKYPSDPSRVTLYGGSTSTSS 100

  Fly   135 GGQLRHVQKTVCHPNYSE--YTMKNDLCMMKLKTPLN--VGR------CVQKVKLPSTRTKRFPK 189
            ||....|.....||||:.  :...:|..:..|..|:|  .||      .:|..:||..     .:
Mosquito   101 GGIEVPVVSIALHPNYNRKAFPAASDCDVAVLNVPVNSFSGRPNMAPLALQTNELPVG-----TE 160

  Fly   190 CYLASGWGLTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICAKRKNR-DTCSGDS 253
            |::. |||.|..|.......||...:..||::.|     .|....|:.|||||..|. |||.|||
Mosquito   161 CFVI-GWGRTGNNQPASVNQLRYANMNIVSQSTC-----ATMWAEYRNMICAKYNNGVDTCGGDS 219

  Fly   254 GGPLVHNGVLYGITSFG-IGCASAKYPGVYVNV 285
            ||.||....|.|:.||. ..|.|| :|..:..:
Mosquito   220 GGALVCGSGLAGVVSFSHPNCTSA-WPAGFAKI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 77/228 (34%)
Tryp_SPc 74..295 CDD:238113 76/227 (33%)
AgaP_AGAP010614XP_001237580.2 Tryp_SPc 36..253 CDD:214473 77/228 (34%)
Tryp_SPc 37..262 CDD:238113 76/227 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.