DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and ovch1

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_956439.2 Gene:ovch1 / 393114 ZFINID:ZDB-GENE-040426-834 Length:556 Species:Danio rerio


Alignment Length:236 Identity:79/236 - (33%)
Similarity:118/236 - (50%) Gaps:23/236 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 TRIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHC--KIGNPGRYTVRAG------ 128
            :||:.||:......|:|.:|.||:...||..||::.|::||.||  :...|..:....|      
Zfish    55 SRIIGGKEAWAHSWPWQVSLQYNDVPTCGGAILDQLWVITAGHCFKRYKKPSMWNAVVGLHNLDN 119

  Fly   129 -STQQRRGGQLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKLPSTRTKRFPKCYL 192
             :...|...|   |||...|.||::.|.:||:.::||::||...:.|:.:.:.:........| .
Zfish   120 ANESSRESIQ---VQKIFSHKNYNQKTNENDIALLKLQSPLVFSKFVRPIGVFNNDLPPLVTC-T 180

  Fly   193 ASGWGLTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMIC--AKRKNRDTCSGDSGG 255
            .:|||..:.|.....| |:.|.|......||.:.|||   |:.|.|||  |.....|.|.|||||
Zfish   181 VTGWGSVTENGPQASR-LQEVNVTVYEPQKCNRFYRG---KVLKSMICAGANEGGMDACQGDSGG 241

  Fly   256 PL-VHNGVLY---GITSFGIGCASAKYPGVYVNVLQYTRWI 292
            || ..:|..|   |:.|:|:||..|:.||||..:..|.:|:
Zfish   242 PLSCFDGERYKLAGVVSWGVGCGRAQKPGVYTTLYHYRQWM 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 78/233 (33%)
Tryp_SPc 74..295 CDD:238113 78/234 (33%)
ovch1NP_956439.2 Tryp_SPc 56..281 CDD:214473 78/232 (34%)
Tryp_SPc 57..281 CDD:238113 77/231 (33%)
Tryp_SPc 331..551 CDD:238113
Tryp_SPc 331..549 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.