DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and CG16998

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster


Alignment Length:234 Identity:85/234 - (36%)
Similarity:123/234 - (52%) Gaps:5/234 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 NALEAQDYLPTRIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHCKIGNPGRYTVR 126
            :||..|:    |||.|.::.....|:..::..:..:.|...::...|::||.|| :..|..|:||
  Fly    17 SALSPQE----RIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGHC-VQYPDSYSVR 76

  Fly   127 AGSTQQRRGGQLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKLPSTRTKRFPKCY 191
            ||||....|||.|:|...:.||:::..|::||:.::||.....:|..:|.||||.......|:..
  Fly    77 AGSTFTDGGGQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGNIQVVKLPLPSLNILPRTL 141

  Fly   192 LASGWGLTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICAKRKNRDTCSGDSGGP 256
            |.:|||...|.....:..|||.:|..:::..||:.|......|...|:||....||.|.||||.|
  Fly   142 LVAGWGNPDATDSESEPRLRGTVVKVINQRLCQRLYSHLHRPITDDMVCAAGAGRDHCYGDSGAP 206

  Fly   257 LVHNGVLYGITSFGIGCASAKYPGVYVNVLQYTRWIKKV 295
            |||.|..|||.||..|||...:||||..:..|..||..|
  Fly   207 LVHRGSSYGIVSFAHGCADPHFPGVYTRLANYVTWIFNV 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 79/218 (36%)
Tryp_SPc 74..295 CDD:238113 80/220 (36%)
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 79/218 (36%)
Tryp_SPc 25..242 CDD:238113 78/217 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 136 1.000 Domainoid score I4883
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 1 1.000 - - H136035
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016607
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.