DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and CG3117

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster


Alignment Length:252 Identity:69/252 - (27%)
Similarity:116/252 - (46%) Gaps:29/252 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 NALEAQDYLPTRIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHCKIG-NPGRYTV 125
            |||:....     |.|.:.|.::.|:..||.....::.|..::....:|||.|...| :|....|
  Fly    85 NALDGSPQ-----VFGDQTKPNQFPWVTALFAKGSYLGGGSLITPGLVLTAAHILAGLSPNDIMV 144

  Fly   126 RAG-----STQQRRGGQLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKLP---ST 182
            |||     |:::......|.|.|.:.|..::..:..|||.::.|.:|..:...:|.::||   .|
  Fly   145 RAGEWDLSSSEKLNPPMDRQVIKIMEHEAFNYSSGANDLALLFLDSPFELRANIQTIRLPIPDKT 209

  Fly   183 RTKRFPKCYLASGWGLTSANAQNVQRYLRGVIVCKVSRAKCQQDYR----GTGIKIYKQMICA-K 242
            ..:|.  |.:| |||:.|:...::|...:.|.:..|..:|||:..|    |:..::...::|| .
  Fly   210 FDRRI--CTVA-GWGMRSSTDVDIQTIQQKVDLPVVESSKCQRQLRLTKMGSNYQLPASLMCAGG 271

  Fly   243 RKNRDTCSGDSGGPLV-------HNGVLYGITSFGIGCASAKYPGVYVNVLQYTRWI 292
            .:.||.||...|..|.       :.....||.|||:||..|..|..:.:|.::..||
  Fly   272 EEGRDVCSLFGGFALFCSLDDDPNRYEQAGIVSFGVGCGQANVPTTFTHVSKFMEWI 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 64/239 (27%)
Tryp_SPc 74..295 CDD:238113 66/240 (28%)
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 65/237 (27%)
Tryp_SPc 95..328 CDD:214473 63/235 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.