DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and CG18636

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster


Alignment Length:283 Identity:71/283 - (25%)
Similarity:105/283 - (37%) Gaps:68/283 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 NPAINALEAQDYLPTRIVNGKKIKCSRAPYQCALH-YNNYFICGCVILNRRWILTAQHCKIGNPG 121
            :||. .:..|.....||:||...|.:.:|:...|| ..:.|:||..::..:.:|||.||.|.|. 
  Fly    30 DPAC-GIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQ- 92

  Fly   122 RYTVRAGSTQQRRGGQL---------RH-VQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQK 176
            ....|.|..::.|..:.         .| |.....|..|...|..||:.:::|.           
  Fly    93 HLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLS----------- 146

  Fly   177 VKLPSTRTKRFPKC---------YL-------ASGWGLTSANA-----QNVQRYLRGVIVCKVSR 220
             |....|....|.|         ||       |:|||.|...:     |.:....:...||.   
  Fly   147 -KSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRRQPPDVCA--- 207

  Fly   221 AKCQQDYRGTGIKIYKQMICAKRKNRDTCSGDSGGPL----VHNG----VLYGITSF-GIGCASA 276
                   :..|..|.....||...:.:.|:|||||||    .|..    |..||.|: ...|..|
  Fly   208 -------KFIGQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKA 265

  Fly   277 KYPGVYVNVLQYTRWIKKVAKKY 299
               .|:.:||.:..:|.:|.:.|
  Fly   266 ---SVFTDVLSHAEFILRVWRMY 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 65/259 (25%)
Tryp_SPc 74..295 CDD:238113 65/261 (25%)
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 65/259 (25%)
Tryp_SPc 45..278 CDD:238113 64/258 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
11.000

Return to query results.
Submit another query.