DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and CTRB1

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001897.4 Gene:CTRB1 / 1504 HGNCID:2521 Length:263 Species:Homo sapiens


Alignment Length:299 Identity:87/299 - (29%)
Similarity:131/299 - (43%) Gaps:54/299 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IANLWIL----VVGGQSKNWSGYYVDNGTHYLLYEGPRIKPQTFLPGNISTNPAINALEAQDYLP 71
            :|:||:|    :||.                           .|..|..:.:|.::.|       
Human     1 MASLWLLSCFSLVGA---------------------------AFGCGVPAIHPVLSGL------- 31

  Fly    72 TRIVNGKKIKCSRAPYQCALH-YNNYFICGCVILNRRWILTAQHCKIGNPGRYTVRAGSTQQ--- 132
            :|||||:.......|:|.:|. ...:..||..:::..|::||.||.:....  .|.||...|   
Human    32 SRIVNGEDAVPGSWPWQVSLQDKTGFHFCGGSLISEDWVVTAAHCGVRTSD--VVVAGEFDQGSD 94

  Fly   133 RRGGQLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKLPSTRTKRFPKCYL--ASG 195
            ....|:..:.|...:|.:|..|:.||:.::||.||....:.|..|.|||. ...||...|  .:|
Human    95 EENIQVLKIAKVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPSA-DDDFPAGTLCATTG 158

  Fly   196 WGLTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICAKRKNRDTCSGDSGGPLV-- 258
            ||.|..||......|:...:..:|.|:|::.:   |.:|...||||......:|.||||||||  
Human   159 WGKTKYNANKTPDKLQQAALPLLSNAECKKSW---GRRITDVMICAGASGVSSCMGDSGGPLVCQ 220

  Fly   259 HNG--VLYGITSFGIGCASAKYPGVYVNVLQYTRWIKKV 295
            .:|  .|.||.|:|....|...||||..|.:...|::|:
Human   221 KDGAWTLVGIVSWGSDTCSTSSPGVYARVTKLIPWVQKI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 75/228 (33%)
Tryp_SPc 74..295 CDD:238113 75/230 (33%)
CTRB1NP_001897.4 Tryp_SPc 33..256 CDD:214473 75/228 (33%)
Tryp_SPc 34..259 CDD:238113 75/230 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.