DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and AgaP_AGAP005310

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_315325.4 Gene:AgaP_AGAP005310 / 1276024 VectorBaseID:AGAP005310 Length:256 Species:Anopheles gambiae


Alignment Length:238 Identity:62/238 - (26%)
Similarity:108/238 - (45%) Gaps:29/238 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 RIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHC--KIGNP---GRYTVRAGSTQQ 132
            |:.:|...:..:.|||.|:......:||.|:::.|:.|||.||  |...|   .:..|..||.:.
Mosquito    24 RVADGSDARRGQFPYQVAMTLKRQTVCGGVMVHERFFLTAAHCFFKGETPLPLEQLNVFYGSEKL 88

  Fly   133 RRGGQLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKLPSTRTKRFPKCYLA--SG 195
            ...|:...|:....|..|...| |.||.::::|...::....:.|:...   :.|.:..||  :|
Mosquito    89 FSNGRYNRVKTVHFHEQYDHGT-KYDLAVVEVKRKFDLTSASRPVEFGQ---EAFGENLLATVTG 149

  Fly   196 WGLTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICAKRKNRDT------CSGDSG 254
            :|..:... |:...|:...:..:..::|::   ..|...|:.:.|.     ||      |.||.|
Mosquito   150 YGRNTVEG-NMAFRLKYAQLTSLPDSQCRE---AMGEDYYEGVFCL-----DTSAGAGFCLGDYG 205

  Fly   255 GPLVHNGVLYGITSFGIG--CASAKYPGVYVNVLQYTRWIKKV 295
            ||.|....|.|:.|:.:|  | .|..|.|:|:|..::.|::.|
Mosquito   206 GPAVFEDRLVGVGSYTVGGKC-EAGLPDVFVDVGHFSEWVQSV 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 60/233 (26%)
Tryp_SPc 74..295 CDD:238113 60/235 (26%)
AgaP_AGAP005310XP_315325.4 Tryp_SPc 21..247 CDD:238113 61/236 (26%)
Tryp_SPc 24..244 CDD:214473 60/233 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.