DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and AgaP_AGAP013089

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_003436251.1 Gene:AgaP_AGAP013089 / 11175918 VectorBaseID:AGAP013089 Length:634 Species:Anopheles gambiae


Alignment Length:296 Identity:85/296 - (28%)
Similarity:128/296 - (43%) Gaps:65/296 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PQTFLPGNISTN--PA--INALEAQDYLPTRIVNGKKIKCSRAPYQCALHYNN---------YFI 98
            |.|..|.:..:|  |.  ::.....:...||:|.|...:.:..|:..||.|.:         .|:
Mosquito   350 PTTVTPSSTGSNRLPTNDVDRCGMSNGTHTRVVGGVDAQLNAWPWMAALGYRSTSFELNAGPRFL 414

  Fly    99 CGCVILNRRWILTAQHCKIGNPGRYTVRAGS---TQQRRGGQL--RHVQKTVCHPNYSEYTMKND 158
            ||..::....:||..||.  ....|.||.|.   |..:.|...  .::|:.|.|..|.|..:.||
Mosquito   415 CGGTLITTLHVLTVAHCI--QTALYFVRLGELDITSDQDGANPVDIYIQRWVVHERYDEKKIYND 477

  Fly   159 LCMMKLKTPLNVGRCVQKVKLP---STRTKRFPKCYLA---SGWGL------TSANAQNVQRYLR 211
            :.::.|:..:.:...|:.:.||   ..|||..  .|.|   :|||.      |:|..|..|    
Mosquito   478 IALVLLQKSVTITEAVRPICLPVEAKQRTKDL--TYYAPFIAGWGAVGYNGPTAARLQEAQ---- 536

  Fly   212 GVIVCKVSRAKCQQDYRGTGIKIY-------KQMICA--KRKNRDTCSGDSGGPLV-----HNGV 262
             |:|..|.  :|..:|     |:|       ..::||  .:..:|:|.|||||||:     .||.
Mosquito   537 -VVVLPVD--QCAFNY-----KLYFPGQIFDDTVLCAGFPQGGKDSCQGDSGGPLMLPELSSNGQ 593

  Fly   263 LY-----GITSFGIGCASAKYPGVYVNVLQYTRWIK 293
            .|     |:.|:|..||.|.:|||||.|..|..||:
Mosquito   594 YYYYTLIGLISYGYECARAGFPGVYVKVTAYLPWIE 629

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 77/263 (29%)
Tryp_SPc 74..295 CDD:238113 78/265 (29%)
AgaP_AGAP013089XP_003436251.1 CLIP 250..304 CDD:288855
Tryp_SPc 380..628 CDD:214473 77/263 (29%)
Tryp_SPc 381..631 CDD:238113 78/265 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.