DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ltl and CG7800

Sequence 1:NP_001261524.1 Gene:ltl FlyBaseID:FBgn0268063 Length:817 Species:Drosophila melanogaster
Sequence 2:NP_649770.1 Gene:CG7800 FlyBaseID:FBgn0037552 Length:533 Species:Drosophila melanogaster

Alignment Length:543 Identity:132/544 (24%)
Similarity:186/544 (34%) Gaps:185/544 (34%)


  Fly   121 LDEIPKHALSHMPSLLTLDIGRCKIRAVQQEDFRGIQRVTNLILVSNIITRLDRGSFPKSLLILH 185
            :|...|..|..||:|.||::..|........|...:..:|:|        :|.||:.        
  Fly    51 MDSCEKKVLKLMPNLRTLELENCDSPDFTMNDLNQLPYLTSL--------QLRRGNL-------- 99

  Fly   186 LGRNQLESLNGSLHDLH-----NLESLFINANNITSLDDELPDG-GQLRLLMAHNNRLERLP--- 241
            ||          |||.|     |::.|.:..||||.|.:|...| .||.||....|.::.||   
  Fly   100 LG----------LHDEHFSKWPNMKILMLGGNNITRLSNECFKGLAQLWLLSLPGNGIQGLPWDV 154

  Fly   242 ---------ANMAGMHSLETVHIHCNQLRSFDRVLRNAVNLSEVMADNNELEYLAQDEFASCSKV 297
                     .:::| :.:||:|         :.:......|..::.:.|.|.::|.....|.|.:
  Fly   155 FQNLPELLHLDLSG-NRIETLH---------ENIFTGVPKLEMLLLNGNPLTWIAPTSLKSLSNL 209

  Fly   298 ETLQMGCNHIKSLNSSLLPILKLKNANFSFNDIEEFSMAELHGLRSLKTLQLSSNRIQRL-LPDP 361
            ..|.|.       |...||.|.|..|:...  ::...:..|..|.|:..||...|.|..: |||.
  Fly   210 RLLDMS-------NCGPLPDLSLPGAHTLI--LDNSGVQRLDILGSVHKLQARKNHITEIKLPDK 265

  Fly   362 RGVQEL--------------------MLVNLDLDNNRIDSLNGALAG---------LGNLRILNL 397
            ..|.||                    .|..|||..|.|...  |.||         |.||..:||
  Fly   266 SSVIELDLHSNLLTATDIPKLLTGMWRLQRLDLSENIIGIY--AAAGSDNTSELFILPNLMYMNL 328

  Fly   398 AGNRLEHL-------------------------QVGDFDGMIRLDILDLTGN-----QLAELKPL 432
            :.|||..|                         :|| .|....|..|.|.||     :|...|| 
  Fly   329 SANRLTRLHFDSPIPWERLTHLDASYNRIYAPAKVG-IDEAFNLQSLHLEGNYINNFELTPWKP- 391

  Fly   433 EMTLLPSLKILKV--------AYNNITKLEQDFKGLPVL--CQANLTNNQISTISSELVTNTRCK 487
                .||||.:.:        .|.||||...:. |:.||  .|.:.:||          |...||
  Fly   392 ----HPSLKEVALYDNKFQPKGYKNITKFFNEI-GVNVLEKTQYSQSNN----------TTPTCK 441

  Fly   488 -----NHNVPGKLEIHLDDNPIMCDVGLNELCR------------------------LMAVQEAR 523
                 ..:.|  ..|..|.|..: |..:|.|..                        .:.|:..|
  Fly   442 PCIPDARDFP--TSISADTNQTI-DTKVNPLSNDTYQWNVWNVLMLVSLIVSLFVNSFLIVKLIR 503

  Fly   524 IRGRSQCFENDQEVCTVLPMLYN 546
            :|||:| |.....|..::.|..|
  Fly   504 LRGRNQ-FTQSSSVPAIIEMFSN 525

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ltlNP_001261524.1 leucine-rich repeat 65..86 CDD:275380
LRR_8 86..145 CDD:290566 9/24 (38%)
leucine-rich repeat 87..110 CDD:275380
leucine-rich repeat 111..134 CDD:275380 5/13 (38%)
leucine-rich repeat 135..158 CDD:275380 5/23 (22%)
LRR_8 158..214 CDD:290566 15/61 (25%)
leucine-rich repeat 159..180 CDD:275380 5/21 (24%)
leucine-rich repeat 181..203 CDD:275380 6/27 (22%)
leucine-rich repeat 204..226 CDD:275380 8/23 (35%)
LRR_RI 226..451 CDD:238064 74/305 (24%)
leucine-rich repeat 227..249 CDD:275380 7/34 (21%)
leucine-rich repeat 250..272 CDD:275380 3/22 (14%)
leucine-rich repeat 273..296 CDD:275380 6/23 (26%)
leucine-rich repeat 297..315 CDD:275380 3/18 (17%)
LRR_8 319..402 CDD:290566 31/113 (27%)
leucine-rich repeat 320..335 CDD:275378 2/15 (13%)
leucine-rich repeat 344..366 CDD:275380 8/23 (35%)
leucine-rich repeat 367..391 CDD:275380 11/53 (21%)
LRR_8 369..426 CDD:290566 26/96 (27%)
leucine-rich repeat 392..415 CDD:275380 10/48 (21%)
leucine-rich repeat 416..439 CDD:275380 9/28 (32%)
LRR_8 438..>479 CDD:290566 15/51 (29%)
leucine-rich repeat 440..462 CDD:275380 8/30 (27%)
leucine-rich repeat 463..483 CDD:275380 5/22 (23%)
CG7800NP_649770.1 leucine-rich repeat 46..64 CDD:275380 5/13 (38%)
leucine-rich repeat 65..85 CDD:275380 5/20 (25%)
LRR_8 87..147 CDD:290566 25/86 (29%)
leucine-rich repeat 89..112 CDD:275380 11/49 (22%)
leucine-rich repeat 113..136 CDD:275380 8/23 (35%)
LRR_RI <131..334 CDD:238064 56/224 (25%)
leucine-rich repeat 137..160 CDD:275380 6/23 (26%)
LRR_8 140..195 CDD:290566 10/65 (15%)
leucine-rich repeat 161..184 CDD:275380 4/33 (12%)
leucine-rich repeat 185..208 CDD:275380 6/23 (26%)
leucine-rich repeat 209..246 CDD:275380 10/46 (22%)
leucine-rich repeat 247..267 CDD:275380 7/20 (35%)
leucine-rich repeat 268..292 CDD:275380 3/24 (13%)
leucine-rich repeat 293..322 CDD:275380 10/31 (32%)
leucine-rich repeat 395..406 CDD:275378 2/11 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C140860629
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.