DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7546 and Bag6

Sequence 1:NP_001137904.1 Gene:CG7546 FlyBaseID:FBgn0035793 Length:1346 Species:Drosophila melanogaster
Sequence 2:XP_006256144.1 Gene:Bag6 RGDID:71064 Length:1219 Species:Rattus norvegicus

Alignment Length:1463 Identity:311/1464 (21%)
Similarity:504/1464 (34%) Gaps:435/1464 (30%)


  Fly     3 INLKVKTLDARIHEFSIDNELTIRQFKDQIAEKTNIAAENQRIIYQGRVLVDDKQVKEYDVDGKV 67
            :.:.|||||::...|.:..::.:::||:.||...:|.:|.||:|||||||.|||::::|:|.|||
  Rat    54 LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQDYNVGGKV 118

  Fly    68 LHVAER-PPFSQRGANARNNDEPMRTFRNVARPPPPGMRTSPYFRALDGMLVGTMAIPVNNGPVA 131
            :|:.|| ||.:|..:.|.:.                               .|:.:.....||:.
  Rat   119 IHLVERAPPQTQLPSGASSG-------------------------------TGSASATHGGGPLP 152

  Fly   132 GTRPP--PNRYPNSSSFCINRITVALHMIDCADNIAAYLENPAVGLNNQSLDILQRGRWSMESTV 194
            |||.|  .....|::|:.:                        ||..|...|          .:.
  Rat   153 GTRGPGASGHDRNANSYVM------------------------VGTFNLPSD----------GSA 183

  Fly   195 VEVGVSSTDLPRNNN-------IIDMVQDAVTAALSHTGARNYTVV-------QLPTVYTNENGE 245
            |:|.::....|..:.       ...|::| :...||....|..|..       |.|||.:.....
  Rat   184 VDVHINMEQAPIQSEPRVRLVMAQHMIRD-IQTLLSRMECRGGTQAQASQPPPQTPTVASETVAL 247

  Fly   246 TSQQRTAEAITSEGAASGAASNASGETTAATVIIEDVIETDDEVADGASDRSVTPTPEPEAEGAV 310
            .||  |:|.:.||...                  .:.:|:::     ..:|..|.|||....|..
  Rat   248 NSQ--TSEPVESEAPP------------------REPMESEE-----MEERPPTQTPELPPSGPA 287

  Fly   311 GGQQVTAAETPTSSVGSANDAAAEGGNNSGPRRRTRPQVLAQVIQHYRGVQARLAPFVDRYYEIL 375
            ......|.||             ...|:..|...      .:|:|..:.:|.||.||:.||.|:|
  Rat   288 PAGPAPAPET-------------NAPNHPSPAEH------VEVLQELQRLQRRLQPFLQRYCEVL 333

  Fly   376 QNDPTFE-ESDTDGRENAQRIFDRVSEAFHYLSHAQHAISDLMLDLSQPGPRVL--------TCR 431
            ....|.: .::.:|||..||:.:.|.|:...|.:...|:|||..:|:...||.|        ...
  Rat   334 GAAATTDYNNNHEGREEDQRLINLVGESLRLLGNTFVALSDLRCNLACAPPRHLHVVRPMSHYTT 398

  Fly   432 PILVEQSGYIRSNNI-----FTPNFLAPPSGIINEPFRNRAPGSASA------AGTQTATTAGTQ 485
            |::::|:......|:     .|.|...||.          |||:.:|      |.:...::|...
  Rat   399 PMVLQQAAIPIQINVGTTVTMTGNGARPPP----------APGAEAASPGSGQASSLPPSSATVD 453

  Fly   486 TPTSAGTPTAVAPSQAANLQAATDASRSA---AAMAEIASRAAGAAAEMAAGAASAAAGAANAAA 547
            :.|....|...||..|.:.......|..:   ..|..:..:.:||   ...|..||..|.. ...
  Rat   454 SSTEGAPPPGPAPPPATSHPRVIRISHQSVEPVVMMHMNIQDSGA---QPGGVPSAPTGPL-GPP 514

  Fly   548 AAARDLSSDQVEDPIDEP--------------MVGPNAAGAETLAQEQQRLEMDHDHDQAQSETP 598
            ...:.|.|..::.|...|              ||...|:.|                  |..:.|
  Rat   515 GHGQSLGSTLIQLPSLPPEFMHAVAHQITHQAMVAAVASAA------------------AGQQVP 561

  Fly   599 ERETRPVPRLRVYVPVTLPPP--------------------NPQLEMARIIQAMVNGQRPNDIHV 643
            ...|.|.   ||.:....||.                    .....:|:::..:|.......:.|
  Rat   562 GFPTAPT---RVVIARPTPPQARPSHPGGPPVSGALQGAGLGTNTSLAQMVSGLVGQLLMQPVLV 623

  Fly   644 EFNAPNVMSINLPVHVMTTVRQAPAAGSNETADQSASESSSPESAPASGNGESPNAASTSSGTRS 708
            ....|.:               |||:.|.....|:.:.:.:|..|||      |..||.|:||  
  Rat   624 AQGTPGM---------------APASASAPATAQAQAPAPAPAPAPA------PATASASAGT-- 665

  Fly   709 GDQRANTLPTTATQTRSTSRPQIQIGGNNNWGGRIAPTHTAFD-RFLPCNSHHIREPEQLLQNNS 772
                .||..|........::|.             .|..:|.| :|           .|||.|  
  Rat   666 ----TNTATTAGPAPGGPAQPP-------------PPQPSAADLQF-----------SQLLGN-- 700

  Fly   773 TSRSTSTAPAGGATVVPPTSAAVTRPV------TTGRIQRGSNTIRPMWSSRRQRPASEQLSNLG 831
             ....:...|||.::..||.......|      .|..:|.......|........||.||     
  Rat   701 -LLGPAGPGAGGPSLASPTITVAVPGVPAFLQGMTEFLQASQAAPPPPPPPPPPPPAPEQ----- 759

  Fly   832 PAAWAQAQTQTTHIPSAHVGAGSTNGAGVGAGRVRPVGGSTINRDRLATRTAHVG---------- 886
                     |||..|.:..| |:.:..|:|...:.|...:::.:..|::....:|          
  Rat   760 ---------QTTPPPGSPSG-GTASPGGLGPESLPPEFFTSVVQGVLSSLLGSLGARAGSSESIA 814

  Fly   887 ------GGSTNGGLP--SGRRGRLQAATSRLSRHLPTQLANFLINNMRNNAPTASVGSAVAAVGD 943
                  .||:|...|  .|..|...|..|.|.:       ||                   ::.|
  Rat   815 AFIQRLSGSSNIFEPGADGALGFFGALLSLLCQ-------NF-------------------SMVD 853

  Fly   944 TAASPSGEAAPIASTTPAAPLQTVLPTSTPTPRGDSNNLRSQLRTFLNDSLFVGVPINEQTIPGA 1008
            ......|...|:                        ..|:.|||:|.:.....|.......|..|
  Rat   854 VVMLLHGHFQPL------------------------QRLQPQLRSFFHQHYLGGQEPTSSNIRMA 894

  Fly  1009 IGRALDWFGESLVY-LPQYERPEYN--SRDSVCNILRVSLRLIIELCNGAPAGV----DSAQFEQ 1066
            .        .:|:. |.:|.|..::  ......:|:|.:|..:.|..|...|.|    ||. |..
  Rat   895 T--------HTLITGLEEYVRESFSLVQVQPGVDIIRTNLEFLQEQFNSIAAHVLHCTDSG-FGA 950

  Fly  1067 SLKQICDQFRKRLYSVLFL---CLGSANAELYWRQLMRLLCAPMRSNFRNEALQFLCIYIDPTIP 1128
            .|.::|:|   .|:..|.|   |||....|         |.|.:....|.     :...::|::.
  Rat   951 RLLELCNQ---GLFECLALNLHCLGGQQME---------LAAVINGRIRR-----MSRGVNPSLV 998

  Fly  1129 AQTDTVDAQQFLV---------------LRSIQAAPPTAADEPFVAPPPFAFNPQQQQLQEQTLD 1178
            :...|:...:..|               :|.|...|....:||.........:|:.|: ::.:..
  Rat   999 SWLTTMMGLRLQVVLEHMPVGPDAILRYVRRIGDPPQALPEEPMEVQGAERTSPEPQR-EDASPA 1062

  Fly  1179 TDVEMSEVTASGSNSSP----ADELPAVIVGSEPWHMSFPNDWLPVITRDLQTQAEQSNRPQPPF 1239
            ......|..:.|...:|    .||.......:|||..:.|.:|:|:|.:|:|:|  :..:||||.
  Rat  1063 PGTTAEEAMSRGPPPAPEGGSRDEQDGASADAEPWAAAVPPEWVPIIQQDIQSQ--RKVKPQPPL 1125

  Fly  1240 SDAYISGMSAKRRKIIQSEKPTASVECLIANGVQRAIQSVGLGGSNGGSALNASISMDTVIGSIA 1304
            ||||:|||.|||||.:|.|.|    :.|::..|.||.::.|........:|:..:....|     
  Rat  1126 SDAYLSGMPAKRRKTMQGEGP----QLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEV----- 1181

  Fly  1305 HDSTIQAAYTDAVRNSLKERTERDVDFKTSKYP 1337
                 |.:|...:|:.:::|.:.|.::...::|
  Rat  1182 -----QESYRQQLRSDIQKRLQEDPNYSPQRFP 1209

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7546NP_001137904.1 UBQ 3..73 CDD:214563 31/70 (44%)
Scythe_N 3..73 CDD:176404 31/70 (44%)
DUF3538 350..466 CDD:288877 35/130 (27%)
Bag6XP_006256144.1 UBQ 54..124 CDD:214563 31/70 (44%)
Scythe_N 54..124 CDD:176404 31/70 (44%)
DUF3538 309..423 CDD:288877 33/114 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C320354914
eggNOG 1 0.900 E1_KOG4248
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 225 1.000 Inparanoid score I3365
OMA 1 1.010
OrthoDB 1 1.010 D1233552at2759
OrthoFinder 1 1.000 FOG0005625
OrthoInspector 1 1.000 T1086003
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR15204
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
109.960

Return to query results.
Submit another query.