DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7546 and AT5G42220

Sequence 1:NP_001137904.1 Gene:CG7546 FlyBaseID:FBgn0035793 Length:1346 Species:Drosophila melanogaster
Sequence 2:NP_001330299.1 Gene:AT5G42220 AraportID:AT5G42220 Length:879 Species:Arabidopsis thaliana

Alignment Length:945 Identity:195/946 (21%)
Similarity:312/946 (33%) Gaps:280/946 (30%)


  Fly     3 INLKVKTLDARIHEFSIDNELTIRQFKDQIAEKTNIAAENQRIIYQGRVLVDDKQVKEYDVD-GK 66
            :.|.:||||:|.:.|.::...|:..||::||.:|.:....||:|::||||.||..:.||.:: |.
plant    24 LELNIKTLDSRTYTFQVNKNETVLLFKEKIASETGVPVGQQRLIFRGRVLKDDHPLSEYHLENGH 88

  Fly    67 VLHV-----AERPPFS---QRGANARN----NDEPMRTFRNVARPPPPGM-----RTS---PYFR 111
            .||:     ||..|.|   .:||.|.:    |..|.|..|:|:.....|.     :|.   |...
plant    89 TLHLIVRQPAESAPSSGTPSQGATANDGNNTNGGPSRNGRHVSHSVVLGSFNVGDQTEGIVPDLS 153

  Fly   112 ALDGMLVGTMAI----PVNNGPVAGTRP--PPNRYPNSSSFCINRITVALHMIDCADNIAAYLEN 170
            .:.|.::.:..:    |.|:. ..||:.  |.|:..|:...            :.:|.      .
plant   154 RVIGAVLNSFGVSGQLPTNHS-TNGTQSSMPSNQSSNAPPG------------NTSDG------E 199

  Fly   171 PAVGLNNQSLDILQRGRWSMESTVVEVGVS-STDLPRNNNIIDMVQDAVTAALSHTGARNYTVVQ 234
            |.:|..:|:....|..:       ...||| .|.:||      :||..||||         |.:.
plant   200 PGIGGQSQATGHSQPRQ-------AFPGVSFQTSMPR------VVQIPVTAA---------TTIP 242

  Fly   235 LPTVYT--NENGETSQQ---RTAEAITSEGAASGAASNASGETTAATVIIEDVIETDDEVADGAS 294
            :|:..|  .::.:|..:   |..:|::..|.....:|..||......:               ..
plant   243 IPSFLTPIPDSLDTLMEFINRMEQALSQNGYQPDTSSAGSGGRPREEL---------------PR 292

  Fly   295 DRSVTPTPEP------EAEGAVGGQQVTAAETPTSSVGSANDAAAEGGNNSGPRRRTRPQVLAQV 353
            :|....|||.      .|:..:.|..|       ||:........:.|::|.|..|::.|..|  
plant   293 NRRGAATPEALSVVLRNAQHLLSGLGV-------SSLSHIAGRLEQDGSSSDPTLRSQIQTEA-- 348

  Fly   354 IQHYRGVQARLAPFVDRYYEILQNDPTFEESDTDGRENAQRIFDRVSEAFHYLSHAQHAISDLML 418
                  ||..||                                           .|| :..|:|
plant   349 ------VQVGLA-------------------------------------------MQH-LGALLL 363

  Fly   419 DLSQPGPRVLTCRPILVEQSGYIRSNNIFTPNFLAPPSG---IINEPFRNRAPGSASAAGTQTAT 480
            :|   |..:||.|.....:..|:.:.    |.....|||   |:.:||    |...|...|....
plant   364 EL---GRTILTLRMAPSPELSYVNAG----PAVYISPSGPNPIMVQPF----PHQISPLFTGATV 417

  Fly   481 TAGTQT-PTSAGTPTAVAPSQA---ANLQAATDASRSAAAMAEIASRAAGAAAEMAAGAASAAAG 541
            ::...| |...||      :|.   .::.|.|..|...:::....|...|       |.....:.
plant   418 SSNPLTGPVGLGT------AQRHINIHIHAGTSGSPMLSSVGNQRSNGEG-------GQGDRDSN 469

  Fly   542 AANAAAAAARDLSSDQVEDPIDEPMVGPNAAGAETLAQEQQRLEMDHDHDQAQS--ETPERETRP 604
            .::..||.....:.:.|...: :|.:|.:.:.|:..|:.:..:.:....||..|  |:.||:...
plant   470 TSSVPAAVPSHSTGENVSAGV-QPGLGDDVSVAQINARIRDMVNIMQGRDQIPSGIESLERDMST 533

  Fly   605 VPRLRVYVPVTLPPPNPQLEMARIIQAMVNGQRPNDIHVEFNAPNVMSINLPVHVMTTVRQAPAA 669
            ...:...:|                                        ..|.::.||.....::
plant   534 GHGVATAMP----------------------------------------EQPTNIATTCAPESSS 558

  Fly   670 GSNETADQSASESSSPESAPASGNGESPNAA----------STSSGTRSGDQRA--NTLPTTATQ 722
            ||........|.|.........|:.|.|..|          |..||..:||.:.  ...|..||.
plant   559 GSLHDLPSERSNSVCQNEKDLGGDLEHPARAKDTSCTTGQSSAPSGDATGDAKETNKATPEVATA 623

  Fly   723 T----------RSTSRPQIQIGGNNNWGGRIAPTHTAFDRFLPCNSHHIREPEQLLQN--NSTSR 775
            |          |.....|.::.|.....|..|.....       ........:||||:  :.:||
plant   624 TPLGLGLGGLDRKKRSKQPKVSGKTEDSGTSATLEGV-------QQSSGTSGQQLLQSLFSGSSR 681

  Fly   776 STSTAPAGG------ATVVPPTSAAVTRPVTTGRI-----QRG---SNTIRPMWSSRRQRPASEQ 826
            |..|....|      ..|....|..:..||..|.:     |.|   .|.:|.|.....|.|   |
plant   682 SDETGLRRGQGSDDRVDVSSAMSQVLESPVLDGLLAGVSRQAGVDSPNMLRNMLQQFTQNP---Q 743

  Fly   827 LSNLGPAAWAQAQTQTTHIPSAHVGAGSTNGAGVG 861
            :.|.......|...|...    ::.:|...|.|.|
plant   744 IMNTVQQIAQQVDGQEIE----NMMSGGAQGEGGG 774

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7546NP_001137904.1 UBQ 3..73 CDD:214563 29/76 (38%)
Scythe_N 3..73 CDD:176404 29/76 (38%)
DUF3538 350..466 CDD:288877 22/119 (18%)
AT5G42220NP_001330299.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_130852
Panther 1 1.100 O PTHR15204
Phylome 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.