DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7546 and AT5G11080

Sequence 1:NP_001137904.1 Gene:CG7546 FlyBaseID:FBgn0035793 Length:1346 Species:Drosophila melanogaster
Sequence 2:NP_001190287.1 Gene:AT5G11080 AraportID:AT5G11080 Length:373 Species:Arabidopsis thaliana

Alignment Length:364 Identity:79/365 (22%)
Similarity:133/365 (36%) Gaps:91/365 (25%)


  Fly     2 LINLKVKTLDARIHEFSIDNE---------------------LTIRQFKDQIAEKTNIAAENQ-R 44
            ||.:|:|.|.:..|..|::..                     :.:|..|..|.....::.|.| |
plant    10 LIRIKIKILHSTTHTLSVERTVRLFFMVKNCVFPCVLLYSIMIPVRDLKQDICYYCGVSPERQPR 74

  Fly    45 IIYQGRVLVDDKQVKEYDV-DGKVLHVAE-RPPFSQRGANARNNDEPMR----------TFRNVA 97
            ::::||||.:|:::.:|.| :|..|::.: .||.....:||..|....|          |.|...
plant    75 LLFRGRVLKNDQRLSDYHVEEGHTLYLVKGSPPIPLFSSNAAANSNLGRGTLTDHSYQLTARGYD 139

  Fly    98 RPP---PPGMRTSPYFRALDGMLVGTMAIPVNNGPVAGTRPPPNRYPNSSSFC--------INRI 151
            .|.   |..:.|  ..|.|| .:....|...||.......|..:|....:..|        ..|:
plant   140 TPSVVIPDSITT--LSRHLD-RIRQVFATYGNNDDNNWQAPNRSREDLIARECHWGELAHTTRRL 201

  Fly   152 TVALHMIDCADNIAAYLENPAVGLNNQSLDILQRGRWSMESTVVE-------VGVSSTDLPRNNN 209
            .:. .:.:|..||:..|.: .|.:.:.|...|::.|      |||       :|.|...|....:
plant   202 LIG-EVAECLSNISMLLVD-QVNVTDPSARRLRQER------VVESGSLLCHLGSSILALGHGTS 258

  Fly   210 IIDM--VQDAVTAA--LSHTGAR----NYTVVQLP-------TVYTNENGETSQQRTAEAITSEG 259
            .|.|  .||.|..|  :|.||..    :::.:|..       .:.:......:||.         
plant   259 RISMGETQDDVGRAVFISPTGQNRLQSHHSWLQTSIRAGRRIRIISRRRSSRNQQH--------- 314

  Fly   260 AASGAASNASGETTAATVIIEDVIETDDEVADGASDRSV 298
              |....|||.:....|  ....:.||:|::|..|:..:
plant   315 --SDLYFNASDQNADNT--SSPRLTTDEELSDSDSEHEM 349

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7546NP_001137904.1 UBQ 3..73 CDD:214563 21/94 (22%)
Scythe_N 3..73 CDD:176404 21/94 (22%)
DUF3538 350..466 CDD:288877
AT5G11080NP_001190287.1 UBQ 11..104 CDD:294102 21/93 (23%)
UBQ 11..102 CDD:214563 21/91 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR15204
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.