DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7546 and BAG6

Sequence 1:NP_001137904.1 Gene:CG7546 FlyBaseID:FBgn0035793 Length:1346 Species:Drosophila melanogaster
Sequence 2:XP_016866764.1 Gene:BAG6 HGNCID:13919 Length:1182 Species:Homo sapiens

Alignment Length:1486 Identity:331/1487 (22%)
Similarity:509/1487 (34%) Gaps:481/1487 (32%)


  Fly     3 INLKVKTLDARIHEFSIDNELTIRQFKDQIAEKTNIAAENQRIIYQGRVLVDDKQVKEYDVDGKV 67
            :.:.|||||::...|.:..::.:::||:.||...:|.:|.||:|||||||.|||:::||:|.|||
Human    17 LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGKV 81

  Fly    68 LHVAERPPFSQRGANARNNDEPMRTFRNVARPPPPGMRTSPYFRALDGMLVGTMAIPVNNGPVAG 132
            :|:.||.|                                |......|...||.:....:|   |
Human    82 IHLVERAP--------------------------------PQTHLPSGASSGTGSASATHG---G 111

  Fly   133 TRPPPNRYPNSSSFCINRITVALHMIDCADNIAAYLENPAVGLNNQSLDILQRGRWSMESTVVEV 197
            ..||..|.|.:|          :|    ..|..:|:   .||..|...|          .:.|:|
Human   112 GSPPGTRGPGAS----------VH----DRNANSYV---MVGTFNLPSD----------GSAVDV 149

  Fly   198 GVSSTDLPRNNN-------IIDMVQDAVTAALSHTGARNYTVVQ------LPTVYTNENGETSQQ 249
            .::....|..:.       ...|::| :...||....|.....|      .|...|.|....|.|
Human   150 HINMEQAPIQSEPRVRLVMAQHMIRD-IQTLLSRMECRGGPQPQHSQPPPQPPAVTPEPVALSSQ 213

  Fly   250 RTAEAITSEGAASGAASNASGETTAATVIIEDVIETDD-EVADGASDRSVTPTPEPEAEGAVGGQ 313
             |:|.:.||...                  .:.:|.:: |....|.:..:||.|.|         
Human   214 -TSEPVESEAPP------------------REPMEAEEVEERAPAQNPELTPGPAP--------- 250

  Fly   314 QVTAAETPTSSVGSANDAAAEGGNNSGPRRRTRPQVLAQVIQHYRGVQARLAPFVDRYYEILQND 378
               |..||.....:.|..:              |....:|:|..:.:::||.||:.||||:|...
Human   251 ---AGPTPAPETNAPNHPS--------------PAEYVEVLQELQRLESRLQPFLQRYYEVLGAA 298

  Fly   379 PTFE-ESDTDGRENAQRIFDRVSEAFHYLSHAQHAISDLMLDLSQPGPRVL-TCRPILVEQSGYI 441
            .|.: .::.:|||..||:.:.|.|:...|.:...|:|||..:|:...||.| ..||:        
Human   299 ATTDYNNNHEGREEDQRLINLVGESLRLLGNTFVALSDLRCNLACTPPRHLHVVRPM-------- 355

  Fly   442 RSNNIFTPNFLAPPSGIINEPFRNRAPGSASAAGTQTATTAGTQTPTSAGTPTAVAPSQAANLQA 506
              ::..||..|...:          .|...:...|.|.|..||:.|.   ||.|.||.....   
Human   356 --SHYTTPMVLQQAA----------IPIQINVGTTVTMTGNGTRPPP---TPNAEAPPPGPG--- 402

  Fly   507 ATDASRSAAAMAEIASRAAGAAAEMAAGAASAAAGAANAAAAAARDLSSDQVEDPIDEPMVGPNA 571
              .||..|.:...:.|.|.||.      ....|...|.:.....| :|...||..:   |:..|.
Human   403 --QASSVAPSSTNVESSAEGAP------PPGPAPPPATSHPRVIR-ISHQSVEPVV---MMHMNI 455

  Fly   572 AGAETLAQEQQRLEMDHDHDQAQSETPERETRP--VPRLRVYVP-----------------VTLP 617
            .|..:|                 |..|:..|:|  ||.    .|                 :.||
Human   456 QGPLSL-----------------SPCPDSGTQPGGVPS----APTGPLGPPGHGQTLGSTLIQLP 499

  Fly   618 --PPNPQLEMARII--QAMV------------------NGQR-------PNDIHVEFNAPNVMSI 653
              ||.....:|..|  ||||                  .||:       |..:.:....|.... 
Human   500 SLPPEFMHAVAHQITHQAMVAAVASAAAALFGLSLLPPTGQQVPGFPTAPTRVVIARPTPPQAR- 563

  Fly   654 NLPVH-----VMTTVRQAPAAGSNETADQSAS-------------ESSSPESAPASGNGESPNAA 700
              |.|     |..|: |....|:|.:..|..|             ...:|..||.    .:|..|
Human   564 --PSHPGGPPVSGTL-QGAGLGTNASLAQMVSGLVGQLLMQPVLVAQGTPGMAPP----PAPATA 621

  Fly   701 STSSGTRSGDQRANTLPTTATQTRSTSRPQI------QIGGN--------NNWGGRIAPTHTAFD 751
            |.|:||.:....|...|....|...|.:|.:      |:.||        ....|..:||.|.  
Human   622 SASAGTTNTATTAGPAPGGPAQPPPTPQPSMADLQFSQLLGNLLGPAGPGAGGSGVASPTITV-- 684

  Fly   752 RFLPCNSHHIREPEQLLQNNSTSRSTSTAPAGGATVVPPTSAAVTRPVTTGRIQRGSNTIRPMWS 816
             .:|.....::.....||      :|.|||       ||.......|                  
Human   685 -AMPGVPAFLQGMTDFLQ------ATQTAP-------PPPPPPPPPP------------------ 717

  Fly   817 SRRQRPASEQLSNLGPAAWAQAQTQTTHIPSAHVGAGSTNGAGVGAGRVRPVGGSTINRDRLATR 881
                 ||.||.:...|.:           ||.  ||||..|.|:.:  :.|...:::.:..|::.
Human   718 -----PAPEQQTMPPPGS-----------PSG--GAGSPGGLGLES--LSPEFFTSVVQGVLSSL 762

  Fly   882 TAHVG----------------GGSTNGGLP--SGRRGRLQAATSRLSRHLPTQLANFLINNMRNN 928
            ...:|                .||:|...|  .|..|...|..|.|.:       ||        
Human   763 LGSLGARAGSSESIAAFIQRLSGSSNIFEPGADGALGFFGALLSLLCQ-------NF-------- 812

  Fly   929 APTASVGSAVAAVGDTAASPSGEAAPIASTTPAAPLQTVLPTSTPTPRGDSNNLRSQLRTFLNDS 993
                       ::.|......|...|:                        ..|:.|||:|.:..
Human   813 -----------SMVDVVMLLHGHFQPL------------------------QRLQPQLRSFFHQH 842

  Fly   994 LFVGVPINEQTIPGAIGRALDWFGESLVYLPQYERPEYN--SRDSVCNILRVSLRLIIELCNGAP 1056
            ...|    ::..|..|..|....   :..|.:|.|..::  ......:|:|.:|..:.|..|...
Human   843 YLGG----QEPTPSNIRMATHTL---ITGLEEYVRESFSLVQVQPGVDIIRTNLEFLQEQFNSIA 900

  Fly  1057 AGV----DSAQFEQSLKQICDQFRKRLYSVLFL---CLGSANAELYWRQLMRLLCAPMRSNFRNE 1114
            |.|    ||. |...|.::|:|   .|:..|.|   |||....|         |.|.:....|. 
Human   901 AHVLHCTDSG-FGARLLELCNQ---GLFECLALNLHCLGGQQME---------LAAVINGRIRR- 951

  Fly  1115 ALQFLCIYIDPTIPAQTDTVDAQQFLVLRSIQAAPPTAADEPF-----VAPPPFAFNPQQQQLQE 1174
                :...::|::.:...|:   ..|.|:.:....|...|...     |..||       |.|.|
Human   952 ----MSRGVNPSLVSWLTTM---MGLRLQVVLEHMPVGPDAILRYVRRVGDPP-------QPLPE 1002

  Fly  1175 QTLDTD-VEMSEVTASGSNSSPA----------------------DELPAVIVGSEPWHMSFPND 1216
            :.::.. .|.:.......|:|||                      ||.......:|||..:.|.:
Human  1003 EPMEVQGAERASPEPQRENASPAPGTTAEEAMSRGPPPAPEGGSRDEQDGASAETEPWAAAVPPE 1067

  Fly  1217 WLPVITRDLQTQAEQSNRPQPPFSDAYISGMSAKRRKIIQSEKPTASVECLIANGVQRAIQSVGL 1281
            |:|:|.:|:|:|  :..:||||.||||:|||.|||||.:|.|.|    :.|::..|.||.::.|.
Human  1068 WVPIIQQDIQSQ--RKVKPQPPLSDAYLSGMPAKRRKTMQGEGP----QLLLSEAVSRAAKAAGA 1126

  Fly  1282 GGSNGGSALNASISMDTVIGSIAHDSTIQAAYTDAVRNSLKERTERDVDFKTSKYP 1337
            .......:|:..:....|          |.:|...:|:.:::|.:.|.::...::|
Human  1127 RPLTSPESLSRDLEAPEV----------QESYRQQLRSDIQKRLQEDPNYSPQRFP 1172

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7546NP_001137904.1 UBQ 3..73 CDD:214563 32/70 (46%)
Scythe_N 3..73 CDD:176404 32/70 (46%)
DUF3538 350..466 CDD:288877 33/118 (28%)
BAG6XP_016866764.1 Scythe_N 17..87 CDD:176404 32/70 (46%)
DUF3538 270..386 CDD:314866 38/136 (28%)
DNA_pol3_gamma3 <955..1146 CDD:331207 56/217 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C320354294
eggNOG 1 0.900 E1_KOG4248
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 229 1.000 Inparanoid score I3403
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1233552at2759
OrthoFinder 1 1.000 FOG0005625
OrthoInspector 1 1.000 T1072343
orthoMCL 1 0.900 OOG5_130852
Panther 1 1.100 LDO PTHR15204
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4967
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.