DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7546 and Bag6

Sequence 1:NP_001137904.1 Gene:CG7546 FlyBaseID:FBgn0035793 Length:1346 Species:Drosophila melanogaster
Sequence 2:XP_006524181.1 Gene:Bag6 MGIID:1919439 Length:1231 Species:Mus musculus

Alignment Length:1451 Identity:309/1452 (21%)
Similarity:505/1452 (35%) Gaps:403/1452 (28%)


  Fly     3 INLKVKTLDARIHEFSIDNELTIRQFKDQIAEKTNIAAENQRIIYQGRVLVDDKQVKEYDVDGKV 67
            :.:.|||||::...|.:..::.:::||:.||...:|.:|.||:|||||||.|||:::||:|.|||
Mouse    58 LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGKV 122

  Fly    68 LHVAERPPFSQRGANARNNDEPMRTFRNVARPPPPGMRTSPYFRALDGMLVGTMAIPVNNG--PV 130
            :|:.||.|                                |..:...|...||.:....:|  |:
Mouse   123 IHLVERAP--------------------------------PQTQLPSGASSGTGSASATHGGAPL 155

  Fly   131 AGTRPPPNRYPNSSSFCINRITVALHMIDCADNIAAYLENPAVGLNNQSLDILQRGRWSMESTVV 195
            .|||.|               ..::|    ..|..:|:   .||..|...|          .:.|
Mouse   156 PGTRGP---------------GASVH----DRNANSYV---MVGTFNLPSD----------GSAV 188

  Fly   196 EVGVSSTDLPRNNN-------IIDMVQDAVTAALSHTGARNYTVVQLPTVYTNENGETSQ--QRT 251
            :|.::....|..:.       ...|::| :...||....|..|..|           .||  .:|
Mouse   189 DVHINMEQAPIQSEPRVRLVMAQHMIRD-IQTLLSRMECRGGTQAQ-----------ASQPPPQT 241

  Fly   252 AEAITSEGAASGAASNASGETTAATVIIEDVIETDDEVADGASDRSVTPTPEPEAEGAVGGQQVT 316
            .:.:.||..|..:.::...|:.|..   .:.:|:::     ..:|..|.|||....|........
Mouse   242 PQTVASETVALNSQTSEPVESEAPP---REPMESEE-----MEERPPTQTPELAPSGPAPAGPAP 298

  Fly   317 AAETPTSSVGSANDAAAEGGNNSGPRRRTRPQVLAQVIQHYRGVQARLAPFVDRYYEILQNDPTF 381
            |...|.....:.|..:              |....:|:|..:.:|.||.||:.||.|:|....|.
Mouse   299 AGPAPAPETNAPNHPS--------------PAEHVEVLQELQRLQRRLQPFLQRYCEVLGAAATT 349

  Fly   382 E-ESDTDGRENAQRIFDRVSEAFHYLSHAQHAISDLMLDLSQPGPRVL--------TCRPILVEQ 437
            : .::.:|||..||:.:.|.|:...|.:...|:|||..:|:...||.|        ...|::::|
Mouse   350 DYNNNHEGREEDQRLINLVGESLRLLGNTFVALSDLRCNLACAPPRHLHVVRPMSHYTTPMVLQQ 414

  Fly   438 SGYIRSNNI-----FTPNFLAPPSGIINEPFRNRA-PGSASAAGTQTATTAGTQTPTSAGTPTAV 496
            :......|:     .|.|...||..    |....| ||||.|.....::|. ..:.|....|...
Mouse   415 AAIPIQINVGTTVTMTGNGARPPPA----PGAEAATPGSAQATSLPPSSTT-VDSSTEGAPPPGP 474

  Fly   497 APSQAANLQAATDASRSA---AAMAEIASRAAGAAAEMAAGAASAAAGAANAAAAAARDLSSDQV 558
            ||..|::.......|..:   ..|..:..:.:||   ...|..||..|.. ......:.|.|..:
Mouse   475 APPPASSHPRVIRISHQSVEPVVMMHMNIQDSGA---QPGGVPSAPTGPL-GPPGHGQTLGSTLI 535

  Fly   559 EDPIDEP--------------MVGPNAAGAETLAQEQQRLEMDHDHDQAQSETPERETRPVPRLR 609
            :.|...|              ||...|:.|                  |..:.|...|.|.   |
Mouse   536 QLPSLPPEFMHAVAHQITHQAMVAAVASAA------------------AGQQVPGFPTAPT---R 579

  Fly   610 VYVPVTLPPP--------------------NPQLEMARIIQAMVNGQRPNDIHVEFNAPNVMSIN 654
            |.:....||.                    .....:|:::..:| ||                  
Mouse   580 VVIARPTPPQARPSHPGGPPVSGALQGAGLGTNTSLAQMVSGLV-GQ------------------ 625

  Fly   655 LPVHVMTTVRQAPAAGSNETADQSASESSSPESAPASGNGESPNAASTSSGTRSGDQRANTLPTT 719
            |.:..:...:..|.....:...|:.:::.:...|||.....:|..||.|:||      .||..|.
Mouse   626 LLMQPVLVAQGTPGMAQAQAQAQAQAQAQAQAPAPAPAPAPAPATASASAGT------TNTATTA 684

  Fly   720 ATQTRSTSRPQIQIGGNNNWGGRIAPTHTAFD-RFLPCNSHHIREPEQLLQNNSTSRSTSTAPAG 783
            .......::|.             .|..:|.| :|           .|||.|   ....:...||
Mouse   685 GPAPGGPAQPP-------------PPQPSAADLQF-----------SQLLGN---LLGPAGPGAG 722

  Fly   784 GATVVPPTSAAVTRPV------TTGRIQRGSNTIRPMWSSRRQRPASEQLSNLGPAAWAQAQTQT 842
            |..:..||.......|      .|..:|.......|........||.||.|...|.:        
Mouse   723 GPGMASPTITVAMPGVPAFLQGMTDFLQASQTAPPPPPPPPPPPPAPEQQSTPPPGS-------- 779

  Fly   843 THIPSAHVGAGSTNGAGVGAGRVRPVGGSTINRDRLATRTAHVG----------------GGSTN 891
               ||    .|:.:..|:|...:.|...:::.:..|::....:|                .||:|
Mouse   780 ---PS----GGTASPGGLGPESLPPEFFTSVVQGVLSSLLGSLGARAGSSESIAAFIQRLSGSSN 837

  Fly   892 GGLP--SGRRGRLQAATSRLSRHLPTQLANFLINNMRNNAPTASVGSAVAAVGDTAASPSGEAAP 954
            ...|  .|..|...|..|.|.:       ||                   ::.|......|...|
Mouse   838 IFEPGADGALGFFGALLSLLCQ-------NF-------------------SMVDVVMLLHGHFQP 876

  Fly   955 IASTTPAAPLQTVLPTSTPTPRGDSNNLRSQLRTFLNDSLFVGVPINEQTIPGAIGRALDWFGES 1019
            :                        ..|:.|||:|.:.....|    ::..|..|..|....   
Mouse   877 L------------------------QRLQPQLRSFFHQHYLGG----QEPTPSNIRMATHTL--- 910

  Fly  1020 LVYLPQYERPEYN--SRDSVCNILRVSLRLIIELCNGAPAGV----DSAQFEQSLKQICDQFRKR 1078
            :..|.:|.|..::  ......:|:|.:|..:.|..|...|.|    ||. |...|.::|:|   .
Mouse   911 ITGLEEYVRESFSLVQVQPGVDIIRTNLEFLQEQFNSIAAHVLHCTDSG-FGARLLELCNQ---G 971

  Fly  1079 LYSVLFL---CLGSANAELYWRQLMRLLCAPMRSNFRNEALQFLCIYIDPTIPAQTDTVDAQQFL 1140
            |:..|.|   |||....|         |.|.:....|.     :...::|::.:...|:...:..
Mouse   972 LFECLALNLHCLGGQQME---------LAAVINGRIRR-----MSRGVNPSLVSWLTTMMGLRLQ 1022

  Fly  1141 V---------------LRSIQAAPPTAADEPFVAPPPFAFNPQQQQLQEQTLDTDVEMSEVTASG 1190
            |               :|.:...|.|..:||.........:|:.|: :..:........|..:.|
Mouse  1023 VVLEHMPVGPDAILRYVRRVGDPPQTLPEEPMEVQGAERTSPEPQR-ENASPAPGTTAEEAMSRG 1086

  Fly  1191 SNSSP----ADELPAVIVGSEPWHMSFPNDWLPVITRDLQTQAEQSNRPQPPFSDAYISGMSAKR 1251
            ...:|    .||.......:|||..:.|.:|:|:|.:|:|:|  :..:||||.||||:|||.|||
Mouse  1087 PPPAPEGGSRDEQDGASADAEPWAAAVPPEWVPIIQQDIQSQ--RKVKPQPPLSDAYLSGMPAKR 1149

  Fly  1252 RKIIQSEKPTASVECLIANGVQRAIQSVGLGGSNGGSALNASISMDTVIGSIAHDSTIQAAYTDA 1316
            ||.:|.|.|    :.|::..|.||.::.|........:|:..:....|          |.:|...
Mouse  1150 RKTMQGEGP----QLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEV----------QESYRQQ 1200

  Fly  1317 VRNSLKERTERDVDFKTSKYP 1337
            :|:.:::|.:.|.::...::|
Mouse  1201 LRSDIQKRLQEDPNYSPQRFP 1221

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7546NP_001137904.1 UBQ 3..73 CDD:214563 32/70 (46%)
Scythe_N 3..73 CDD:176404 32/70 (46%)
DUF3538 350..466 CDD:288877 36/130 (28%)
Bag6XP_006524181.1 UBQ 58..128 CDD:214563 32/70 (46%)
Scythe_N 58..128 CDD:176404 32/70 (46%)
DUF3538 319..433 CDD:288877 33/114 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C320355349
eggNOG 1 0.900 E1_KOG4248
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 231 1.000 Inparanoid score I3413
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1233552at2759
OrthoFinder 1 1.000 FOG0005625
OrthoInspector 1 1.000 T1082406
orthoMCL 1 0.900 OOG5_130852
Panther 1 1.100 LDO PTHR15204
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4967
TreeFam 1 0.960
1211.890

Return to query results.
Submit another query.