DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7546 and ZK688.5

Sequence 1:NP_001137904.1 Gene:CG7546 FlyBaseID:FBgn0035793 Length:1346 Species:Drosophila melanogaster
Sequence 2:NP_498714.1 Gene:ZK688.5 WormBaseID:WBGene00022800 Length:1620 Species:Caenorhabditis elegans

Alignment Length:1506 Identity:333/1507 (22%)
Similarity:489/1507 (32%) Gaps:475/1507 (32%)


  Fly     3 INLKVKTLDARIHEFSIDNELTIRQFKDQIAEKTNIAAENQRIIYQGRVLVDDKQVKEYDV-DGK 66
            |.:.:||||.|....:|..:.||:...|....:.||.:..||:|..||||...:.|:...: ||:
 Worm    21 IRVTLKTLDDREATVTIGLQDTIQSLIDLGRREMNIQSGFQRVIAGGRVLNSTQTVQAAGISDGQ 85

  Fly    67 VLHVAERPPFSQRGANARNNDEPMRTFRNVARP---------PPPG-MRTSPYFRALDGMLVGTM 121
            .:|:.:|.|   .|.|.|.|..|.|    ||.|         |||| :..||.|..   |:.|.:
 Worm    86 TVHLVDRGP---SGENDRPNVMPDR----VAGPRIINAIPGLPPPGFIFQSPAFAR---MIPGNV 140

  Fly   122 AIPVNNGPVAGTRPPPNRYPNS---SSFCINRITVALHMIDCADNIAAYLENPAVGLNN-----Q 178
            .||........|...|.|.|.|   :....:|::.     ||....|.    |..|.:|     |
 Worm   141 EIPTPPSQTQHTVVHPIRVPGSIAGTPVLTSRVSE-----DCVLQKAV----PYRGTSNSPNRPQ 196

  Fly   179 SLDILQRGRWSMESTVVEVGVSSTD----LPRNN---------NIIDMVQDAVTAALSHTGARNY 230
            :..  |...:..|..|::..|:..|    .||.:         |.|..:.|:....:|....:|.
 Worm   197 AAS--QTVTFPSEPNVIQWTVNIADDLIFRPREHFEQVVRETINNISFLSDSTRLGVSMKWNQNC 259

  Fly   231 T--VVQLPTVYTNENGETSQQRTAEAITSEGAAS--GAASNASGETTAATVIIEDVIET---DDE 288
            |  .|:||.|..:......::.....:.::..:.  .......| ..|||..:.::::|   |..
 Worm   260 TSLSVELPPVSPHIPSPALEKLDFLCLWTDHLSRFIDKLEEHDG-LVAATRHVLEMVKTRQFDQN 323

  Fly   289 VADGASDRSVTPTPE---------------------------PEAEGAVGGQQVTAAETPTSS-- 324
            ::..|.::.|....|                           .|...|:..|:.  .|||.:.  
 Worm   324 LSQQARNQRVEALDEIVKHLEYQWAELSHMKDFERIRFRKNQTEEYRALKIQEY--PETPRNPHF 386

  Fly   325 -VGSANDAAAEGGNNSGPRRRTRPQVLAQVIQHYRGVQ---ARLAPFVDRYYEI-----LQNDPT 380
             :..|.|....|                 |::.:|..|   .||...:|...|:     :::..|
 Worm   387 YMRHALDIDVIG-----------------VMREFRKQQRRFTRLEDLLDDLNEVGAVKFIRDHIT 434

  Fly   381 FEESDTDGRENAQRIF-DRVSEAFHYLSHAQHAISDLMLDLSQPG--PRVLTCRPILVEQSG--- 439
               ::.|.|..|..:| ..:....|.:||..|..:||.:....|.  .|:|   |....||.   
 Worm   435 ---TEVDYRYQALSMFYCYIQRMRHQISHMTHLTADLDVSFITPSFPQRIL---PQYAFQSSDEQ 493

  Fly   440 --YIRSNNIFTP---------------NFLA--PPS----GIINEPFRNRAPGSASAAGTQTATT 481
              .|...:||.|               .:||  |||    .::.||.|...|.....|.......
 Worm   494 PLTIPVTHIFEPPRMLSDVGGRYNGDYPYLAYHPPSVHMEVVLQEPRRIAEPRPQILARPTPQQF 558

  Fly   482 AGTQTPTSAGTPTAVAPSQAANLQAATDASRSAAAMAEIASRAAGAAAE--------MAAGAASA 538
            ..||.....|         :.||.||||.. |..::.::. ||.....|        :..|....
 Worm   559 VLTQEMNQGG---------SINLMAATDPI-SGLSLQDVL-RAQQEQVENLFAQQPGIEGGRVRV 612

  Fly   539 AAGAANAAAAAARDLSSDQVE---DPIDEPMVG-------------PNAAGA--ETLA------- 578
            .|.......|...|..|..||   .|..:...|             |:|.||  ||||       
 Worm   613 TARPGRRFVATTGDAPSVPVETLPPPGSDQQPGTSRRFTTHRFNVQPDARGAETETLAPFPVAIE 677

  Fly   579 -QEQQRLEMDHDHDQAQSETPER--------------ETR----PVPRLRVYVPVTL----PPPN 620
             .|.||: ..:...:.::|..:|              :||    |:..||..|.:.|    ...|
 Worm   678 PNELQRI-AKNIASRYRAEALQRIASSLTTRFNNESWDTRIQNMPLCTLRECVAIALEMLTSAGN 741

  Fly   621 PQLEMARIIQAMVNGQRPNDIHVEFNAPNVMSI----NLPVHV----MTTVRQAPAAGSNETADQ 677
            ...|...::.|:|   |..::.|...|..:.|:    ..|.||    |.|.:.|.:....|:.| 
 Worm   742 TVNESKDLMLALV---RDEEVLVRAIAECIKSLFGRGEFPTHVARLIMPTNQTASSRNDYESVD- 802

  Fly   678 SASESSSPE------------SAPASGN------------------GESPNAASTSSGTR----- 707
            ...||.|.|            |.|.||:                  |..|:.:|..|.:.     
 Worm   803 GVEESQSDEFDSMIVRVPSDISQPQSGDLRAIRERRQNRRQFLENRGRIPSTSSAPSTSENPPGP 867

  Fly   708 ------SGDQRANTLPTTATQTRSTSRPQIQIGG-------NNNWGGRIAPTHTAFDRFLPCNSH 759
                  :.|.||..||......|.|.|..:....       |:......|.|||    |.|... 
 Worm   868 SFNSEDAADIRAGRLPLGTRPNRRTVRETVHPAAAARAESPNHISLTFTATTHT----FAPAGF- 927

  Fly   760 HIREPEQLLQNNSTSRSTSTAPAGG--ATVVPPTSAAVTR---------------------PVTT 801
                  .|:..:|...|||..|.|.  ..||.||  ..||                     |..|
 Worm   928 ------PLMMASSNVPSTSAGPPGWPIRQVVSPT--PTTRGLFEFDLSGSSDQPARSTPSPPAPT 984

  Fly   802 GRIQRGSNTIRPMWSSRRQRPA---SEQLSNLG----PAAWAQAQTQTTHIPSAHVG--AGSTNG 857
            .|......|::.  |..||...   |..:.|.|    ||  |.|..|...:..|.:.  |.:.||
 Worm   985 PRTTSAPATVQS--SPTRQESMDIDSPNVQNPGHVESPA--AIAARQAARVARARIDHLAATFNG 1045

  Fly   858 AGVGAGRVRPV---GGST----------------------------INR----DRLATRTAHVGG 887
            ....:.|..|.   |.:|                            .||    :||||.| |:..
 Worm  1046 DLADSRRQSPFVTPGPTTPLNDPRRRTVRVTQHVKPMVAIDPFMNCTNRHCEINRLATPT-HMAD 1109

  Fly   888 GS--TNGGLPSGR--RGRLQAATSRLSRHLPTQL------ANFLI----------NNMRNNAPTA 932
            |.  |...|...:  ..|:||....:.|. |.|:      .|:.|          .|:.:..|  
 Worm  1110 GDRFTLQSLQPDQEFEARIQALVPSIERR-PIQIHHEDEDYNYSIRRTQSGLLSFRNLEDFRP-- 1171

  Fly   933 SVGSAVAAV-------------------GDTAAS---------------PSGEAAPIASTTPAAP 963
            .|.:|:.::                   |..||:               |...|     |..|:.
 Worm  1172 FVKTAIRSLLAHCIDADTLFTMNMNNISGYQAANHTELLRMVKEHISRVPGSRA-----TRNASQ 1231

  Fly   964 LQTVLPTSTPT-PRGDSNNLRSQLRTFLNDSL-FVGVP--IN---EQTIPGAIGRALDWFGESLV 1021
            ..|.:..||.| ||...|  ||.::...:..| |...|  ||   |..|||.|       ...|.
 Worm  1232 NTTSVNQSTETSPREQMN--RSPVQEAADPRLAFSPFPPGINLEQEVLIPGQI-------ASLLT 1287

  Fly  1022 YLPQYERPEYNSRDSVCNILRVSLRLIIELCNGAPAGVDSAQFEQ--SLKQICDQFRKRLYSVL- 1083
            ||..|.....|.|....      ...::||..|.....|.||..:  :...:..:|..::.:.: 
 Worm  1288 YLVDYMESSSNPRPPGI------FGFLLELTYGRLTRHDFAQLARRTTATNVASEFEAQIRAHIR 1346

  Fly  1084 --FLC--LGSANAELYWRQLMRLLCAPMRSNFRNEALQFLCIYID-----PT-IPAQTDTVD-AQ 1137
              :|.  .|.:|:||:          .:..|..|.. ||..|::.     || .|...|..| |:
 Worm  1347 DNYLVGRTGLSNSELH----------GIAENLANNE-QFFAIFMSQNDQLPTSFPFGYDRNDFAE 1400

  Fly  1138 QFLVLRSIQAA 1148
            .....|.|:.|
 Worm  1401 VVWAFRQIEIA 1411

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7546NP_001137904.1 UBQ 3..73 CDD:214563 23/71 (32%)
Scythe_N 3..73 CDD:176404 23/71 (32%)
DUF3538 350..466 CDD:288877 36/153 (24%)
ZK688.5NP_498714.1 UBQ 21..92 CDD:214563 23/71 (32%)
UBQ 21..92 CDD:294102 23/71 (32%)
DEATH 329..435 CDD:214467 19/128 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C320337392
eggNOG 1 0.900 E1_KOG4248
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR15204
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.890

Return to query results.
Submit another query.