DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8539 and ECM14

DIOPT Version :9

Sequence 1:NP_001261520.1 Gene:CG8539 / 38842 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_012000.1 Gene:ECM14 / 856533 SGDID:S000001174 Length:430 Species:Saccharomyces cerevisiae


Alignment Length:339 Identity:75/339 - (22%)
Similarity:153/339 - (45%) Gaps:25/339 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IVVNQLSEAREVRRRRGLM-----LQLDNYLSYDGIMQYLDELALSHSNRVTLKDVARTYENRAL 73
            ::.|.|..::.:.|.:.:.     ...:.|...|.|..:||.|..|..:.|.::.:.||:|.|.|
Yeast    92 LIQNTLPTSQMMAREQAVFENDYDFFFNEYRDLDTIYMWLDLLERSFPSLVAVEHLGRTFEGREL 156

  Fly    74 KMAIITNG--DGRPGKRVIFLDAALHSREWMTPAAALLTIHKLVVEFA---ENSDLLTDYDWHIM 133
            |...|:..  :..|.|:.|.:...:|:|||::.:.....:::|:..:.   :.:..|.|.|:.::
Yeast   157 KALHISGNKPESNPEKKTIVITGGIHAREWISVSTVCWALYQLLNRYGSSKKETKYLDDLDFLVI 221

  Fly   134 PLANPDGYEYSRNTERYWR-NTRTPNGGNCFGTNLNRNFAVDWNVGFPELKDPCDENYAGSSPFS 197
            |:.|||||.|:.:.:|.|| |.:..:...|.|.:::.:|...|......   .|.|.|:|.:||.
Yeast   222 PVFNPDGYAYTWSHDRLWRKNRQRTHVPQCLGIDIDHSFGFQWEKAHTH---ACSEEYSGETPFE 283

  Fly   198 EVEARTVRDIMHGLVESKRAVMYLSLHTANRSVFYPWVYDTDPVSNQKEH-DEIGRFVADRILQS 261
            ..||......::......:...|:.:|:.::.:.||:.|..|.:....|: .|:...::..|...
Yeast   284 AWEASAWYKYINETKGDYKIYGYIDMHSYSQEILYPYAYSCDALPRDLENLLELSYGLSKAIRSK 348

  Fly   262 TGTFIKTWQYAK------YAGTFGGTSMDYALLAGFPLSFVFEMSGTGRDHVEYKFFPPARDIRH 320
            :|.........|      :.|...|:::|:........:|..::..||    .:.|..|..:|:.
Yeast   349 SGRNYDVISACKDRGSDIFPGLGAGSALDFMYHHRAHWAFQLKLRDTG----NHGFLLPPENIKP 409

  Fly   321 LAEESWTGIKAFAE 334
            :.:|::..:|.|.:
Yeast   410 VGKETYAALKYFCD 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 72/310 (23%)
ECM14NP_012000.1 M14_CP_A-B_like 121..425 CDD:349433 72/310 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.