DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8539 and cpb2

Sequence 1:NP_001261520.1 Gene:CG8539 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001025617.1 Gene:cpb2 XenbaseID:XB-GENE-969491 Length:421 Species:Xenopus tropicalis

Alignment Length:347 Identity:97/348 (28%)
Similarity:163/348 (47%) Gaps:33/348 (9%)


  Fly    10 VLVTIVVNQLSEA------REVRRRRGLMLQLDNYLSYDGIMQYLDELALSHSNRVTLKDVARTY 68
            :|..::||...|.      .:...:|......:.|.:.:.|..::..:...||:.:....:..::
 Frog    88 ILYMVLVNNAQELIEQQTFNDTSNQRSATSFYEQYHTLEDIYYWMQHMVEKHSDMLQRIHIGYSF 152

  Fly    69 ENRALKMAIITNGDGRPGKRVIFLDAALHSREWMTPAAALLTIHKLVVEFAEN---SDLLTDYDW 130
            |||.| ..:..:|..:..|..:::|..:|:|||::||..|..:...|..:..:   :.||...|:
 Frog   153 ENRPL-YVLKVSGKEKTAKHAVWIDCGIHAREWISPAFCLWFVGHAVEYYGVDLSMTKLLRYLDF 216

  Fly   131 HIMPLANPDGYEYSRNTE-RYWRNTRTP-NGGNCFGTNLNRNFAVDWNVGFPELKDPCDENYAGS 193
            :|:|:.|.|||::|...: |.||..|:. ...||.||:|||||...| .|.....|||.|.|.| 
 Frog   217 YILPVMNADGYQFSWTAKNRMWRKNRSKYTKSNCIGTDLNRNFDAGW-CGPGASSDPCHEIYCG- 279

  Fly   194 SPFSEVEARTVRDIMHGLVESKRAVM-YLSLHTANRSVFYPWVYDTDPVSNQKEHDE---IGRFV 254
             |::|.|.. |..::..|.:.:..|. |:::|:.::.|.:|:.|..   ...|:|||   :.:.|
 Frog   280 -PYAESEPE-VSAVVSFLKKHQNVVKGYITVHSYSQMVLFPYSYTN---KKSKDHDELLLLSKKV 339

  Fly   255 ADRILQSTGTFIKTWQYAKYAGTF---GGTSMDYALLAGFPLSFVFEMSGTGRDHVEYKFFPPAR 316
            |:.| :||..  ..:.|...|.|.   .|.|.|:|...|...||.||:    ||...|.|..|.:
 Frog   340 AEGI-RSTSR--NKYMYGAGAETIYLAPGGSDDWAYDLGIKYSFTFEL----RDKGMYGFLLPPQ 397

  Fly   317 DIRHLAEESWTGIKAFAEKTIE 338
            .|:....|..|.:|..|...::
 Frog   398 LIKPTCSEGITAVKIIAAHIVK 419

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 92/309 (30%)
cpb2NP_001025617.1 Propep_M14 28..104 CDD:308061 4/16 (25%)
M14_CPB2 118..418 CDD:199868 92/315 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C70125384
eggNOG 1 0.900 E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.