DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8539 and Cpb2

Sequence 1:NP_001261520.1 Gene:CG8539 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_062749.2 Gene:Cpb2 MGIID:1891837 Length:422 Species:Mus musculus

Alignment Length:304 Identity:89/305 (29%)
Similarity:148/305 (49%) Gaps:22/305 (7%)


  Fly    36 DNYLSYDGIMQYLDELALSHSNRVTLKDVARTYENRALKMAIITNGDGRPGKRVIFLDAALHSRE 100
            :.|.|.:.|..:::.:...|.:.:....:..::|...|.:..::..:.|. |..|::|..:|:||
Mouse   120 EQYHSLNEIYSWIEVITEQHPDMLQKIYIGSSFEKYPLYVLKVSGKEQRI-KNAIWIDCGIHARE 183

  Fly   101 WMTPAAALLTIHKLVVEF--AEN--SDLLTDYDWHIMPLANPDGYEYSRNTERYWRNTRTPNGGN 161
            |::||..|..| ..|.:|  .||  :.||...|::|||:.|.|||:|:....|.||..|:.:..|
Mouse   184 WISPAFCLWFI-GYVTQFHGKENLYTRLLRHVDFYIMPVMNVDGYDYTWKKNRMWRKNRSAHKNN 247

  Fly   162 -CFGTNLNRNFAVDWNVGFPELKDPCDENYAGSSPFSEVEARTVRDIMHGLVESKRAVMYLSLHT 225
             |.||:||||||.............|.|.|.|..|.||.|.:.|.|.:...::..:|  |:|:|:
Mouse   248 RCVGTDLNRNFASKHWCEKGASSSSCSETYCGLYPESEPEVKAVADFLRRNIDHIKA--YISMHS 310

  Fly   226 ANRSVFYPWVYDTDPVSNQKEHDEIGRFVADRILQSTGTFIKTWQYAKYAGTFG-----GTSMDY 285
            .::.:.:|:.|:.   |..|:|:|:. .||...:::..:..|..:|...:|:..     |.|.|:
Mouse   311 YSQQILFPYSYNR---SKSKDHEELS-LVASEAVRAIESINKNTRYTHGSGSESLYLAPGGSDDW 371

  Fly   286 ALLAGFPLSFVFEMSGTGRDHVEYKFFPPARDIRHLAEESWTGI 329
            ....|...||..|:..|||    |.|..|.|.|:....|:...|
Mouse   372 IYDLGIKYSFTIELRDTGR----YGFLLPERYIKPTCAEALAAI 411

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 89/303 (29%)
Cpb2NP_062749.2 Propep_M14 32..103 CDD:280416
M14_CPB2 118..419 CDD:199868 89/305 (29%)
Substrate binding. {ECO:0000250|UniProtKB:P00730} 180..183 2/3 (67%)
Substrate binding. {ECO:0000250|UniProtKB:P00730} 255..256 1/1 (100%)
Substrate binding. {ECO:0000250|UniProtKB:P00730} 310..311 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C70126283
eggNOG 1 0.900 E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.