DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8539 and CG4408

Sequence 1:NP_001261520.1 Gene:CG8539 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_651141.2 Gene:CG4408 FlyBaseID:FBgn0039073 Length:479 Species:Drosophila melanogaster

Alignment Length:299 Identity:89/300 (30%)
Similarity:145/300 (48%) Gaps:40/300 (13%)


  Fly    61 LKDVARTYENRALKMAIITNGDGRP-----------GKRVIFLDAALHSREWMTPAAALLTIHKL 114
            ||.:|.|:. ..|.:.:..:..|||           .:..:|:::.:|:|||:.||.|...|.:|
  Fly   189 LKKLAETHP-EVLLVELGVSAQGRPILGVQIAFDNENRTTVFVESGIHAREWIAPATATYIIDQL 252

  Fly   115 VVEFAENSD------LLTDYDWHIMPLANPDGYEYSRNTERYWRNTRTPNGGNCFGTNLNRNFAV 173
            |     ||.      |.....|:|.|..|||||:|:...:|.||..|. ..|.|.|.:|||||..
  Fly   253 V-----NSKDSAVQALARSQRWYIFPTVNPDGYQYTFKGDRMWRKNRA-LFGICRGVDLNRNFPF 311

  Fly   174 DWNV----GFPELKDPCDENYAGSSPFSEVEARTVRDIMHGLVESKRAVMYLSLHTANRSVFYPW 234
            .|||    |     |||..:|:|.|..||||.:.:.:.:...|||:|...::|||:.::.:.:|:
  Fly   312 HWNVTGASG-----DPCRYDYSGPSAASEVETQRMIEFIRHRVESERIRTFISLHSYSQMIMFPY 371

  Fly   235 VYDTDPVSNQKEHDEIGRFVADRILQSTGTFIKTWQYAKYAGTFGGTSMDYALLAG---FPLSFV 296
            .:..:.|.|..:..:||:..|::|...:|...|:....:......|.|.|:|  .|   .|::|.
  Fly   372 GHSAERVDNYHDLTDIGKLAANKIKDVSGRIYKSGSIYETIYPSSGGSKDWA--HGQLKIPITFS 434

  Fly   297 FEMSGTGRDHVEYKFFPPARDIRHLAEESWTGIKAFAEK 335
            :|:.|....  |..|...|::|...|.|::..|:...::
  Fly   435 YELRGPADS--EDLFILSAKEIEPTAAEAFASIQTIVQE 471

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 89/298 (30%)
CG4408NP_651141.2 Propep_M14 88..159 CDD:280416
M14_CP_A-B_like 179..472 CDD:199844 89/300 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C70140879
eggNOG 1 0.900 E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I2432
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11705
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.