DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8539 and Cpa5

Sequence 1:NP_001261520.1 Gene:CG8539 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001002808.2 Gene:Cpa5 RGDID:1303098 Length:436 Species:Rattus norvegicus

Alignment Length:346 Identity:96/347 (28%)
Similarity:163/347 (47%) Gaps:36/347 (10%)


  Fly    10 VLVTIVVNQLSEAREVRRRRGLMLQLDNYLSY------DGIMQYLDELALSHSNRVTLKDVARTY 68
            |::..:...|.|.|:...|...:.:..|..||      :.|..::|.....|||.|:...:.:::
  Rat   105 VMIKDIQVLLDEERDAMARSRRLERSTNGFSYSSYHTLEEIYNWIDNFVAEHSNLVSKIHIGKSF 169

  Fly    69 ENRALKMAIITNGDGRPGKRVIFLDAALHSREWMTPAAALLTIHKLVVEFAEN---SDLLTDYDW 130
            |||::  .::....|.|.:..|::|..:|||||:|.|..:....|:|..::::   ..:|...|.
  Rat   170 ENRSI--LVLKFSTGGPNRTAIWIDTGIHSREWITHATGIWISQKIVNAYSKDHVLKKVLNTMDI 232

  Fly   131 HIMPLANPDGYEYSRNTERYWRNTRTPNGG-NCFGTNLNRNFAVDWNVGF---PELKDPCDENYA 191
            .|..:.||||:.::.:..|.||..::...| .|.|.:||||    |..||   ...|:||.|.|.
  Rat   233 FIEIVTNPDGFAFTHSMNRLWRKNKSIQPGIVCVGVDLNRN----WRTGFGGNGSNKNPCSETYR 293

  Fly   192 GSSPFSEVEARTVRDIMHGLVESKRAVMYLSLHTANRSVFYPWVYDTDPVSNQKEHDEIGRFVAD 256
            |.:|.||.|...:...:.|....|..:   |:|:.::.|.||:.:..:||.|.||..|:.:....
  Rat   294 GPAPESEPEVAAIVAFITGHGNFKAMI---SIHSYSQMVMYPYGHSLEPVPNHKELFELAKDAVK 355

  Fly   257 RILQSTGT-----FIKTWQYAKYAGTFGGTSMDYALLAGFPLSFVFEMSGTGRDHVEYKFFPPAR 316
            .:.:..|.     .|.|..|:.     .|.::|:|..:|...:|.||:..||    :|.|..||.
  Rat   356 ALYKVHGMEYIFGSISTTLYSA-----SGITVDWAYDSGIKYAFSFELRDTG----QYGFLLPAS 411

  Fly   317 DIRHLAEESWTGIKAFAEKTI 337
            .|...|||:|..::...:.|:
  Rat   412 QIVPTAEETWMALRTIMKHTL 432

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 89/315 (28%)
Cpa5NP_001002808.2 Propep_M14 44..116 CDD:280416 2/11 (18%)
Peptidase_M14_like 134..434 CDD:299699 90/318 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C70157550
eggNOG 1 0.900 E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.