DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8539 and CG17633

Sequence 1:NP_001261520.1 Gene:CG8539 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_609310.2 Gene:CG17633 FlyBaseID:FBgn0032144 Length:430 Species:Drosophila melanogaster

Alignment Length:343 Identity:104/344 (30%)
Similarity:163/344 (47%) Gaps:50/344 (15%)


  Fly    16 VNQLSEAREVRRRRGLMLQLDNYLSYDGIMQYLDELALSHSNRVTLKDVARTYENRALKMAIIT- 79
            ::::.|...::.|.........|...|....:|..||.::...|||.:..:||:.|::....|| 
  Fly   103 LDEIDEKVAIKGRATTAYNWAQYYELDDTYAWLQSLAQTNPGVVTLIEGGKTYQGRSILGVKITK 167

  Fly    80 -----NGDGRPGKRVIFLDAALHSREWMTPAAALLTIHKLVVEFAEN-SDLLTDYDWHIMPLANP 138
                 ||..:||   |||:|.:|:|||:.||||...|::|:....|| .:|..:|.|:::|.|||
  Fly   168 GGETINGKAKPG---IFLEAGIHAREWIAPAAATFIINQLLTSEVENIKELAENYTWYVLPHANP 229

  Fly   139 DGYEYSRNTERYWRNTRTPNGGNCFGTNLNRNFAVDWN-VGFPELKDPCDENYAGSSPFSEVEAR 202
            |||.|:..|.|.||.||||. |:|||.:.|||:...|| ||  .....|.:.|||.|.|||:|..
  Fly   230 DGYVYTHTTNRLWRKTRTPY-GSCFGADPNRNWGFHWNEVG--ASSSACSDTYAGPSAFSEIETL 291

  Fly   203 TVRDIMHGLVESKRAVMYLSLHTANRSVFYPWVYDTDPVSNQKEHDEI----------------- 250
            ::...:.||  ..:..:|||||..::.:.||:.:.:|...|..:.:::                 
  Fly   292 SLSKFIEGL--KGKVQLYLSLHAYSQYLLYPYGHTSDLPDNVADFEKVFDASIAAVNKRYGTTYT 354

  Fly   251 GRFVADRILQSTGTFIKTWQYAKYAGTFGGTSMDYALLAGFPLSFVFEMSGTGRDHVEYKFFPPA 315
            |..:.|.|..:.|..: .|.|        ||.       ...::|.:|:..:...::. .|..||
  Fly   355 GGNIYDAIYPAAGASV-DWAY--------GTQ-------DVRMAFCYELRPSSTSYLT-GFKLPA 402

  Fly   316 RDIRHLAEESWTGIKAFA 333
            ..|...:||....|.|.|
  Fly   403 EQIVPASEELLDSIVAMA 420

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 102/322 (32%)
CG17633NP_609310.2 MpaA 7..374 CDD:225421 90/280 (32%)
Propep_M14 34..105 CDD:280416 0/2 (0%)
M14_CP_A-B_like 125..423 CDD:199844 102/322 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C70164122
eggNOG 1 0.900 E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I2432
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11705
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.