DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8539 and CG18585

Sequence 1:NP_001261520.1 Gene:CG8539 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001260213.1 Gene:CG18585 FlyBaseID:FBgn0031929 Length:422 Species:Drosophila melanogaster

Alignment Length:313 Identity:101/314 (32%)
Similarity:158/314 (50%) Gaps:28/314 (9%)


  Fly    38 YLSYDGIMQYLDELALSHSNRVTLKDVARTYENRALKMAIITNGDGRPGKRVIFLDAALHSREWM 102
            |...:.|..:|||:..::.:......|.::||.|.::...|::..|.||   ||:::.:|:|||:
  Fly   122 YYELEEIEAWLDEILNAYPSVTEEFIVGKSYEGRTIRGIKISHKAGNPG---IFIESNIHAREWI 183

  Fly   103 TPAAALLTIHKLVV-EFAENSDLLTDYDWHIMPLANPDGYEYSRNTERYWRNTRTPNGGN-CFGT 165
            |.|:|...|::|:. |.|:...|..:|||||:|:.|.||:|||...:|.||.||.|:..| |.|.
  Fly   184 TSASATWFINQLLTSEDADVRSLADNYDWHIIPVFNVDGFEYSHKKDRMWRKTRQPHATNACIGA 248

  Fly   166 NLNRNFAVDW--NVGFPELKDPCDENYAGSSPFSEVEARTVRDIMHGLVESKRAVMYLSLHTANR 228
            :.||||...|  |.|..:  :||.|.:||.:|.||.||:.:.:.:..:.:  :..:|:|.|:..:
  Fly   249 DANRNFDSYWLQNNGASD--NPCSETFAGDNPESEPEAKALVEYLTKIQD--QISVYISFHSYGQ 309

  Fly   229 SVFYPWVYDTDPV-SNQKEHDEIGRFVADRI-LQSTGTFIKTWQYAK-----YAGTFGGTSMDYA 286
            .:..|:.:..:.. .|..:...||:..||.| ....||   .:||..     |..|  |||:|:.
  Fly   310 YLLSPYGHTNEEFPENYNDILTIGKAFADAIEALPYGT---VYQYGSTADVLYVAT--GTSVDWV 369

  Fly   287 L-LAGFPLSFVFEMSGTGRDHVEYKFFPPARDIRHLAEESWTGIKAFAEKTIE 338
            . ..|..:.:..|....||    |.|..|...|....||...|:.|..|||.|
  Fly   370 FNELGKKIGYTIEYRDKGR----YGFILPPVQIIPNCEELMVGMLALIEKTKE 418

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 98/309 (32%)
CG18585NP_001260213.1 Propep_M14 34..105 CDD:280416
M14_CP_A-B_like 122..415 CDD:199844 98/309 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C70140158
eggNOG 1 0.900 E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I2432
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11705
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.