DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8539 and Cpa6

Sequence 1:NP_001261520.1 Gene:CG8539 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_011236694.1 Gene:Cpa6 MGIID:3045348 Length:459 Species:Mus musculus

Alignment Length:244 Identity:72/245 (29%)
Similarity:116/245 (47%) Gaps:20/245 (8%)


  Fly    14 IVVNQLSEARE-------VRRRRGLM-LQLDNYLSYDGIMQYLDELALSHSNRVTLKDVARTYEN 70
            :::..|.:|.|       .|.||.|. ...:.|.|.:.|..:|..|..:....|.:..:.|:||.
Mouse   107 VLIEDLQKAVENENSLQTQRNRRSLSEYNYEVYHSLEDIQSWLHHLNQTQPGLVRVFSIGRSYEG 171

  Fly    71 RALKMAIITNG-DGRPGKRVIFLDAALHSREWMTPAAALLTIHKLVVEFAEN---SDLLTDYDWH 131
            |.|  .|:..| ..|..||.:::|..:|:|||:.||.....:.:.::.:..:   ..:|....::
Mouse   172 RPL--FIMQLGRKSRAYKRAVWIDCGIHAREWIGPAFCQWFVREAILTYKTDPAMKKMLNHLYFY 234

  Fly   132 IMPLANPDGYEYSRNTERYWRNTRTPNGG-NCFGTNLNRNFAVDW-NVGFPELKDPCDENYAGSS 194
            |||:.|.|||.:|...:|:||.||:.:.. .|.|.:.|||:.|.| :.|  ....|||:.|.|..
Mouse   235 IMPVFNVDGYHFSWTHDRFWRKTRSRDSKFRCRGVDANRNWKVKWCDEG--ASAHPCDDTYCGPF 297

  Fly   195 PFSEVEARTVRDIMHGLVESKRAVMYLSLHTANRSVFYPWVYDTDPVSN 243
            |.||.|.:.|.:.:.  ...||...|||.|...:.:.||:.|....:.|
Mouse   298 PESEPEVKAVANFLR--KHRKRIRAYLSFHAYAQMLLYPYSYKYATIPN 344

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 65/213 (31%)
Cpa6XP_011236694.1 Propep_M14 44..118 CDD:280416 3/11 (27%)
Peptidase_M14_like 138..382 CDD:299699 65/214 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C70000997
eggNOG 1 0.900 E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.