DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8539 and cpb1

Sequence 1:NP_001261520.1 Gene:CG8539 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001315354.1 Gene:cpb1 ZFINID:ZDB-GENE-030131-1132 Length:416 Species:Danio rerio

Alignment Length:357 Identity:100/358 (28%)
Similarity:167/358 (47%) Gaps:63/358 (18%)


  Fly    12 VTIVVNQLSEAREVRRRRGLMLQLDN-----------YLSYDGIMQYLDELALSHSNRVTLKDVA 65
            |.::::.|.||        :..|:||           |.|:..|..:...::.::.:.::.:.:.
Zfish    88 VKVMIDNLQEA--------VKGQMDNRSPTKGHDYTKYNSWATINDWAISISSANPDLISRQSIG 144

  Fly    66 RTYENRALKMAIITNGDGRPGKRVIFLDAALHSREWMTPAAALLTIHKLVVEFAENSD---LLTD 127
            .|||.|.:.:..|....| ..|..:|:|...|:|||:|.|.....:::.|..:..:.|   ||..
Zfish   145 NTYEGRTMHLLKIGKNTG-SNKPAVFMDCGFHAREWITHAFCQWFVNEAVSTYGSDPDMTNLLDR 208

  Fly   128 YDWHIMPLANPDGYEYSRNTERYWRNTRTPN-GGNCFGTNLNRNFAVDW-NVGFPELKDPCDENY 190
            .|:.::|:.|.|||||:.|.:|.||.||:.| |.:|.||:.||||...| .||  ...:||.:.|
Zfish   209 MDFFVLPVFNIDGYEYTWNRDRMWRKTRSKNSGSSCIGTDPNRNFNAGWCTVG--ASSNPCSDTY 271

  Fly   191 AGSSPFSEVEARTVRDIMHGLVESKRAVM--YLSLHTANRSVFYPWVYDTDPVSNQKEHDEI--- 250
            .||||.||:|::.:.:    .:.:.::|:  ||::|:.::.:.:|:.|..|..::   |.|:   
Zfish   272 CGSSPESEIESKNLAN----FIRTNKSVIKAYLTVHSYSQLLLFPYSYKYDLAAH---HSELMSV 329

  Fly   251 --GRFVADRILQSTGTFIKTWQYAKYAGTFG--------GTSMDYALLAGFPLSFVFEMSGTGRD 305
              |...|.|.|..|          ||....|        |.|.|:|...|...|:.||:    ||
Zfish   330 SQGAIAALRSLYGT----------KYTSGPGAATIYPAAGGSDDWAYDLGVKYSYTFEL----RD 380

  Fly   306 HVEYKFFPPARDIRHLAEESWTGIKAFAEKTI 337
            ...|.|..|...|:...||:...:|..|...:
Zfish   381 EGRYGFLLPESQIKPTCEETMLAVKYIANHVL 412

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 93/317 (29%)
cpb1NP_001315354.1 Propep_M14 27..99 CDD:280416 4/19 (21%)
M14_CPB 112..412 CDD:199852 93/324 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C70024500
eggNOG 1 0.900 E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.