DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8539 and CG3108

Sequence 1:NP_001261520.1 Gene:CG8539 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_572262.1 Gene:CG3108 FlyBaseID:FBgn0029807 Length:1132 Species:Drosophila melanogaster

Alignment Length:339 Identity:106/340 (31%)
Similarity:168/340 (49%) Gaps:23/340 (7%)


  Fly    24 EVRRRRGLMLQLDNYLSYDGIMQYLDELALSHSNRVTLKDVARTYENRALKMAIITNGDGR-PGK 87
            |::.|:|..|....|...:.|..::|.:|.::.:..:.:.:..:.|.|.||:..|:||:.| || 
  Fly   807 ELQNRKGHRLTWQAYHRLEDIHGFIDYMAKTYPDICSTEIIGYSVEKRPLKILKISNGNARNPG- 870

  Fly    88 RVIFLDAALHSREWMTPAAALLTIHKLVVEFAENSDLLTDYDWHIMPLANPDGYEYSRNTERYWR 152
              |::|..:|:|||::||......::||..:.:..:.:...:|:|.|:|||||||||..|:|.||
  Fly   871 --IWIDGGMHAREWISPATVTYIANQLVEGWEDLPEHMRSINWYIHPVANPDGYEYSHTTDRLWR 933

  Fly   153 NTRTPNGGNCFGTNLNRNFAVDWNVGFPELKDPCDENYAGSSPFSEVEARTVRDIMHGLV-ESKR 216
            .....:|..|.|.:|||||...|. |......||.:.|.||..|||.|...:...:.|.. |:.:
  Fly   934 KNMRAHGRQCPGVDLNRNFGYKWG-GKGTSASPCSQTYRGSKAFSEPETFYISKFISGFPRETFQ 997

  Fly   217 AVMYLSLHTANRSVFYPWVYDTDPVSNQKEHDEIGRFVADRILQSTGTFIKTWQYAKYAGTFGGT 281
            |  |||.|:..:.:.|||.||.....::.:.|.:.|.....|.:|||........|.......|.
  Fly   998 A--YLSFHSYGQYILYPWGYDYQLTQDRADLDRVARQAGTSITKSTGVKYTVGSSATTLYPAAGG 1060

  Fly   282 SMDYAL-LAGFPLSFVFEMSGTGRDHVEYKFFPPARDIRHLAEESWTGIKAFAEKTIEKYPPSRV 345
            |.|:|. :||...::..||..|||    |.|..|||.|::..::..|    ||:..      :|.
  Fly  1061 SDDWAKGIAGIKYAYTIEMGDTGR----YGFVLPARFIQYNGKDGVT----FADTV------ARA 1111

  Fly   346 ISYNPMVKLAENAA 359
            |:......:|.|::
  Fly  1112 IAQGRGKSVARNSS 1125

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 98/300 (33%)
CG3108NP_572262.1 Propep_M14 730..797 CDD:280416
M14_CP_A-B_like 821..1112 CDD:199844 99/311 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C70163422
eggNOG 1 0.900 E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11705
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.