DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8539 and ZC434.9

Sequence 1:NP_001261520.1 Gene:CG8539 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001251356.1 Gene:ZC434.9 WormBaseID:WBGene00013895 Length:720 Species:Caenorhabditis elegans

Alignment Length:424 Identity:108/425 (25%)
Similarity:174/425 (41%) Gaps:110/425 (26%)


  Fly    24 EVRRRRGLMLQ------LDNYL-----SYDGIMQYLDELALS----------------------- 54
            :|..|..:|:.      ||:.|     |||.|::.:.:|.|.                       
 Worm    68 KVGHRADIMVDEDRMEWLDSVLKNSNISYDVIIEDVGKLILEKEHGPPRFSNLLFSKRMHNEGGN 132

  Fly    55 ---------HSNRVT---LKDVARTYENRALKMAIITNGDGRP-------------GKRVIFLDA 94
                     ||.:..   :||:.|.|.::|....:.|..:|||             .||:.::|.
 Worm   133 RARYGFGEYHSYQTICDWMKDIERKYPDKAKVFTMGTTSEGRPIQGIKIGSQVWRNDKRIFWIDG 197

  Fly    95 ALHSREWMTPAAALLTIHKLVVEFAENSDLLTDYD---WHIMPLANPDGYEYSRNTE----RYWR 152
            .:|:|||.....||..|.:|:.::.::|.:....|   ::|:|:||||||||||:..    |.||
 Worm   198 GIHAREWAAVHTALWFIDRLIADYNDDSLVRAAVDRLNFYILPVANPDGYEYSRSDVSPMIRLWR 262

  Fly   153 NTRTP---------NGGNCFGTNLNRNFAVDWNVG-FPELKDPCDENYAGSSPFSEVEARTVRDI 207
            ..|..         ....|.|.:||||:  ||:.| .....|.|.|.|.|||.|||.|.|::||.
 Worm   263 KNRAGVVCKKDRWFRDRCCGGVDLNRNY--DWHFGETGSSTDKCSEIYQGSSAFSESETRSMRDF 325

  Fly   208 MHGLVESKRAVMYLSLHTANRSVFYPWVYDTDPV-SNQKEHDEIGRFVADRILQSTGTFIKTWQY 271
            :.....:.:...:::|||.::...:|:.:....| ::..|...:||.....:..:.||..|....
 Worm   326 LTSSELNGKIDAFITLHTYSQMWIHPYSHARKSVPADVAELQRVGRAAVAALENTYGTKYKFGTG 390

  Fly   272 AKYAGTFGGTSMDYALLAGFPLSFVFEMSGTGRDHVEYKF---FPPARDI-------RH----LA 322
            :.......|.|.|:|             .||.|  ::|.:   ..|..|:       :|    .|
 Worm   391 SDILYPSAGGSDDWA-------------KGTLR--IKYVYLLELRPGEDVWDGFILDQHQLIPTA 440

  Fly   323 EESWTGIKAFAEKTIEKYP--PSRVISYNPMVKL 354
            :|:|.|||.......|:..  |:.:.|..|.:.|
 Worm   441 KETWNGIKVVIRAVTEQAGSLPNSIASTLPPITL 474

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 98/382 (26%)
ZC434.9NP_001251356.1 Propep_M14 37..107 CDD:280416 11/39 (28%)
M14_CP_A-B_like 141..454 CDD:199844 91/330 (28%)
ShK 682..719 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11705
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.