DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8539 and Y18H1A.9

Sequence 1:NP_001261520.1 Gene:CG8539 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_490776.2 Gene:Y18H1A.9 WormBaseID:WBGene00021213 Length:488 Species:Caenorhabditis elegans

Alignment Length:400 Identity:114/400 (29%)
Similarity:177/400 (44%) Gaps:71/400 (18%)


  Fly    14 IVVNQLSEAREVR--------RRRGLMLQLDNYLSYDGIMQYLDELALSHSNRVTLKDVARTYEN 70
            ::|.|..:..::|        |.:.:...|..|.|:..::.||:.||:::...|:::.:..|:|.
 Worm    93 VIVEQKEKRDKLRKQVRLHDWREQKVQFNLAQYHSFADVINYLNSLAITYPELVSVQPIGTTHEG 157

  Fly    71 RALKMAIITNGDGRPGKRVIFLDAALHSREWMTPAAALLTIHKLVVEFAEN---SDLLTDYDWHI 132
            |.:.:..|||......||.|::|..:|:|||::|:..|..||:||.::.::   ...:...:|:|
 Worm   158 RQIPLIKITNKRNGGTKRGIWVDGGIHAREWVSPSTVLYFIHQLVTQYDKDVQIKQFVDQLEWYI 222

  Fly   133 MPLANPDGYEYSRNTE----RYWRNTRT--------------PNGGNCFGTNLNRNFAVDWNVG- 178
            :||.|||||||||::.    |.||..|:              |....|.|.:|||||  ||..| 
 Worm   223 VPLLNPDGYEYSRSSNDPEIRLWRKNRSPPKCIQQATGLFQPPTTTCCQGVDLNRNF--DWFFGQ 285

  Fly   179 FPELKDPCDENYAGSSPFSEVEARTVRDIMHGLVESKRAVMYLSLHTANRSVFYPWVYDTDPVSN 243
            .....|||.|.|.|:..|||.|...|||    .|:..|...:|:.|:.::.:.||:.:.....||
 Worm   286 VGSSTDPCSEIYQGAYAFSEPETAAVRD----FVQRHRISTFLTFHSYSQILMYPFGHQVRTYSN 346

  Fly   244 QKEHDEIGRFVADRILQSTGTFIKTWQYAKYAGTFGGTSMDYALLAGFPLSFVFEMSGTGRDHVE 308
            ...........|.:.|.|    :...||..      ||..|..    :|.|...|....|:.||:
 Worm   347 DLNDLRSTALSAAQALNS----VYNTQYKV------GTGADTL----YPASGGSEDWAKGKAHVK 397

  Fly   309 YKFFPPAR--------------DIRHLAEESWTGIKAFAEKTIE------KYPPSRVISYNPMV- 352
            |.|....|              .|...|.|:|..:|..|.||||      :.|..|.|.::.:. 
 Worm   398 YSFLFELRPEEQVWDGFLLAENQIIPTARETWEAVKVIASKTIELPSNMHRAPAKRCIDHDSLCP 462

  Fly   353 KLAENAATRN 362
            ..|:..|..|
 Worm   463 SWAQGGACEN 472

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 99/333 (30%)
Y18H1A.9NP_490776.2 Propep_M14 25..94 CDD:280416 0/1 (0%)
M14_CP_A-B_like 125..438 CDD:199844 99/333 (30%)
ShKT 454..487 CDD:214586 4/19 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11705
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.