DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8539 and Cpa1

Sequence 1:NP_001261520.1 Gene:CG8539 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_079626.2 Gene:Cpa1 MGIID:88478 Length:419 Species:Mus musculus

Alignment Length:351 Identity:99/352 (28%)
Similarity:169/352 (48%) Gaps:39/352 (11%)


  Fly    10 VLVTIVVNQLSEARE---VRRRRGLMLQLDNYLSY---DGIMQYLDELALSHSNRVTLKDVARTY 68
            :::..|.:.|.|.::   ..:.|.|.....||.:|   |.|.:::|.|...|...|:...:..|:
Mouse    88 IMIEDVQSLLDEEKQQMSAFQARALSTDAFNYATYHTLDEIYEFMDLLVTEHPQLVSKIQIGSTF 152

  Fly    69 ENRALK-MAIITNGDGRPGKRVIFLDAALHSREWMTPAAALLTIHKLVVEFAENSDL---LTDYD 129
            |.|.:. :...|.|..||   .|::|..:|||||:|.|:.:....|:..::.:...|   |.:.|
Mouse   153 EGRPINVLKFSTGGTNRP---AIWIDTGIHSREWVTQASGVWFAKKITKDYGQEPTLTAILDNMD 214

  Fly   130 WHIMPLANPDGYEYSRNTERYWRNTRTPNGGN-CFGTNLNRNFAVDWNVGF---PELKDPCDENY 190
            ..:..:.||||:.|:..|.|.||.||:...|: |.|.:.|||    |:..|   ....:||.|.|
Mouse   215 IFLEIVTNPDGFVYTHKTNRMWRKTRSHTEGSLCVGVDPNRN----WDAAFGMPGASSNPCSETY 275

  Fly   191 AGSSPFSEVEARTVRDIM--HGLVESKRAVMYLSLHTANRSVFYPWVYDTDPVSNQKEHDEIGRF 253
            .|..|.||||.:::.|.:  ||.:::     ::|:|:.::.:.||:.|.::|..:::|.|::.:.
Mouse   276 RGKFPNSEVEVKSIVDFVTSHGNIKA-----FISIHSYSQLLLYPYGYTSEPAPDKEELDQLAKS 335

  Fly   254 VADRILQSTGTFIKTWQYAKYAGTF---GGTSMDYALLAGFPLSFVFEMSGTGRDHVEYKFFPPA 315
            ....:....||..|   |.....|.   .|:::|:....|...||.||:..||.    ..|..||
Mouse   336 AVTALTSLHGTKFK---YGSIIDTIYQASGSTIDWTYSQGIKYSFTFELRDTGL----RGFLLPA 393

  Fly   316 RDIRHLAEESWTGIKAFAEKTIEKYP 341
            ..|...|||:|..:....:.|: |:|
Mouse   394 SQIIPTAEETWLALLTIMDHTV-KHP 418

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 90/313 (29%)
Cpa1NP_079626.2 Propep_M14 27..99 CDD:280416 2/11 (18%)
M14_CPA 117..417 CDD:133081 93/320 (29%)
Substrate binding. {ECO:0000250|UniProtKB:P00730} 179..182 3/3 (100%)
Substrate binding. {ECO:0000250|UniProtKB:P00730} 254..255 1/1 (100%)
Substrate binding. {ECO:0000250|UniProtKB:P00730} 307..308 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C69709428
eggNOG 1 0.900 E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.