DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8539 and cpa3

Sequence 1:NP_001261520.1 Gene:CG8539 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_017949540.1 Gene:cpa3 XenbaseID:XB-GENE-853724 Length:332 Species:Xenopus tropicalis

Alignment Length:330 Identity:88/331 (27%)
Similarity:168/331 (51%) Gaps:32/331 (10%)


  Fly    28 RRGLMLQLDN-----------YLSYDGIMQYLDELALSHSNRVTLKDVARTYENRALKMAIITNG 81
            :.|:..||:|           |.:::.|:::..:|...:.|.|...|:.::.|.|.:.:..:.|.
 Frog    13 QEGIEAQLNNTKKSKRHSYTKYNTWEKIVEWTSKLTKKYPNLVQRIDIGKSVEGRPMYVLQVGNP 77

  Fly    82 DGRPGKRVIFLDAALHSREWMTPAAALLTIHKLVVEFA---ENSDLLTDYDWHIMPLANPDGYEY 143
            |.  ..:.||:|..:|:|||::||.....:.::::.:|   .::.|:....::|:|:.|.|||.:
 Frog    78 DS--ATKAIFMDCGIHAREWISPAFCQWFVKEVMITYALCLLHTQLVKSLTFYILPVFNIDGYVW 140

  Fly   144 SRNTERYWRNTRTPN-GGNCFGTNLNRNFAVDW-NVGFPELKDPCDENYAGSSPFSEVEARTVRD 206
            :...:|.||..|:|: ...|.||:|||||.:.| ::|..:  :||.|.|.|::..||:|.:.|..
 Frog   141 TWTEDRMWRKNRSPSEDAKCVGTDLNRNFNISWCDIGSSD--EPCSEIYCGAAAESEIETKNVAS 203

  Fly   207 IMHGLVESKRAVMYLSLHTANRSVFYPWVYDTDPVSNQKEHDEIGRFVADRILQSTGTFIKTWQY 271
            .:...|:|.:|  |:|.|:.::.:.:|:.|..:...:.||.|||.:   ..:.:..|.:..::.|
 Frog   204 FIRSHVDSIKA--YISFHSFSQMLLFPFSYTYELAPDHKELDEIAK---GAVAELQGLYGTSYTY 263

  Fly   272 AKYAGTF---GGTSMDYALLAGFPLSFVFEMSGTGRDHVEYKFFPPARDIRHLAEESWTGIKAFA 333
            ...|.|.   .|:|.|:|...|...||.||:    ||..:..|..|...|:...:|:...:...|
 Frog   264 GPSASTIYPTAGSSDDWAYSLGIKYSFTFEL----RDEGKKGFLLPQSQIKATCQETTLAVAYIA 324

  Fly   334 EKTIE 338
            :..::
 Frog   325 KYVLD 329

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 84/305 (28%)
cpa3XP_017949540.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C69375166
eggNOG 1 0.900 E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.